Citrus Sinensis ID: 025698

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25

MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRARIAEKKQRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA

ccEEEEcccccCEEEEEEccHHHHHHHHHcccccCCccccccccccccEEEEcccccccccccccccccccEEEEEECcccccccccccccccCEECccccccccccccEEEEEEEEccccccccccccccccccccccccHHHcccccccccccEEEEEEcEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc

MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGR*DGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDL*****************SKIRKLFNLSKEDDVRKYVNTYRRTF************KIQRLVTPLTLQRKRA******************YQ***********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxLATRLKEQRERRSESLAKKRSRLSAASKPSIAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
40S ribosomal protein S6-2	May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.	confident	P51430
40S ribosomal protein S6	May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.	confident	Q9M3V8
40S ribosomal protein S6-1	May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.	confident	O48549

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5C, chain G
Confidence level:very confident
Coverage over the Query: 1-222
View the alignment between query and template
View the model in PyMOL