Citrus Sinensis ID: 025713


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MDKDRENFVYIAKLAEQAERYDANLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEARGNELNVKRIKEYRQKVEAELSKISTDIMQVIDEHLIPSCTGGESTVFYYKMKGDYYRYLAEFKTGDERKDVADLSMKAYQAASTTAEAELSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGGDEAQKMDISAKDGEGED
cccHHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccHHHccccccccccccc
***DRENFVYIAKLAEQAERYDANLDVELTVEERNLLSVGYKNVIGARRASWRILSSI************VKRIKEYRQKVEAELSKISTDIMQVIDEHLIPSCTGGESTVFYYKMKGDYYRYLAEFKTGDERKDVADLSMKAYQAASTTAEAELSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTS************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKDRENFVYIAKLAEQAERYDANLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEARGNELNVKRIKEYRQKVEAELSKISTDIMQVIDEHLIPSCTGGESTVFYYKMKGDYYRYLAEFKTGDERKDVADLSMKAYQAASTTAEAELSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGGDEAQKMDISAKDGEGED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA damage checkpoint protein rad24 Required for the DNA damage checkpoint that ensures that DNA damage is repaired before mitosis is attempted. Acts as a negative regulator of meiosis by antagonizing the function of mei2. It inhibits the association of meiRNA (a non-coding RNA molecule required for the nuclear mei2 dot formation) to the phosphorylated but not to the unphosphorylated form of mei2 in vitro.confidentP42656
14-3-3 protein epsilon Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.confidentQ5ZMT0
14-3-3-like protein D confidentQ96453

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UZD, chain A
Confidence level:very confident
Coverage over the Query: 2-224
View the alignment between query and template
View the model in PyMOL