BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025742
         (248 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2FHB|A Chain A, Crystal Structure Analysis Of Klebsiella Pneumoniae
           Pullulanase Complexed With Maltose
 pdb|2FHC|A Chain A, Crystal Structure Analysis Of Klebsiella Pneumoniae
           Pullulanase Complexed With Maltotriose
 pdb|2FHF|A Chain A, Crystal Structure Analysis Of Klebsiella Pneumoniae
           Pullulanase Complexed With Maltotetraose
          Length = 1083

 Score = 28.9 bits (63), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 2   NDEQVSPIGRMEDDDMGPQWLKPMLRASYFIPCVVHGDSNK 42
           ND   +P G    D  GP W+ P+ + S  I  +V   +NK
Sbjct: 96  NDVSTTPTG---SDKYGPYWVIPLTKESGCINVIVRDGTNK 133


>pdb|4GRH|A Chain A, Crystal Structure Of Pabb Of Stenotrophomonas Maltophilia
          Length = 457

 Score = 28.1 bits (61), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 4/54 (7%)

Query: 117 PGKGVTNTCEICCRSLLDSFRFCSLGCKLGAM----KRGDLDLTFTLRVKHKDG 166
           PG  +T   ++ C  ++        G   GA     + GDLDL   +R    DG
Sbjct: 365 PGGTITGCPKVRCMQIISELEQVPRGAYTGAFGWLNRDGDLDLNILIRTAEVDG 418


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,948,539
Number of Sequences: 62578
Number of extensions: 311265
Number of successful extensions: 606
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 605
Number of HSP's gapped (non-prelim): 3
length of query: 248
length of database: 14,973,337
effective HSP length: 96
effective length of query: 152
effective length of database: 8,965,849
effective search space: 1362809048
effective search space used: 1362809048
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)