BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025747
         (248 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
           In Complex With Initiation Factor 1. This File Contains
           The 40s Subunit And Initiation Factor For Molecule 1
 pdb|2XZN|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
           In Complex With Initiation Factor 1. This File Contains
           The 40s Subunit And Initiation Factor For Molecule 2
          Length = 343

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 21/48 (43%)

Query: 163 KKQLDALGGVGGVGFTPHVITVKAGEDISSKIFAFSQQGPRTVCILSA 210
           +++ DA   +  + F P +  V  G D   KIF    Q    VC + A
Sbjct: 249 QREFDAGSTINQIAFNPKLQWVAVGTDQGVKIFNLMTQSKAPVCTIEA 296


>pdb|3VTH|A Chain A, Crystal Structure Of Full-Length Hypf In The Phosphate-
           And Nucleotide-Bound Form
 pdb|3VTH|B Chain B, Crystal Structure Of Full-Length Hypf In The Phosphate-
           And Nucleotide-Bound Form
 pdb|3VTI|A Chain A, Crystal Structure Of Hype-Hypf Complex
 pdb|3VTI|B Chain B, Crystal Structure Of Hype-Hypf Complex
          Length = 761

 Score = 30.0 bits (66), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 155 RGRPPGSGKKQLDALGGVGGVGFTPHVITVKAGEDISSKIF 195
           RGR P    +Q++  G V GVGF P V  +    ++   ++
Sbjct: 3   RGRVPQIQARQINIFGIVQGVGFRPFVFNIAQKYNLKGIVY 43


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.138    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,294,157
Number of Sequences: 62578
Number of extensions: 160172
Number of successful extensions: 298
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 296
Number of HSP's gapped (non-prelim): 2
length of query: 248
length of database: 14,973,337
effective HSP length: 96
effective length of query: 152
effective length of database: 8,965,849
effective search space: 1362809048
effective search space used: 1362809048
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)