BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025815
         (247 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ZWM|A Chain A, Nmr Structure Of Murine Gamma-S Crystallin
 pdb|1ZWO|A Chain A, Nmr Structure Of Murine Gamma-S Crystallin
 pdb|2A5M|A Chain A, Nmr Structure Of Murine Gamma-S Crystallin From Joint
           Refinement With Saxs Data
          Length = 177

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 6/71 (8%)

Query: 135 EFLKYLDQFGKTKVHAQSCPLF------GHAHAPAPCRCPMMQAWGSLDALVGRLRAAYE 188
           +F  YL +    +V   +  ++      GH +       P  Q W  L+  +G  RA + 
Sbjct: 28  DFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLGSCRAVHL 87

Query: 189 ENGGQPEINPF 199
            +GGQ +I  F
Sbjct: 88  SSGGQAKIQVF 98


>pdb|3RNL|A Chain A, Crystal Structure Of Sulfotransferase From
           Alicyclobacillus Acidocaldarius
          Length = 311

 Score = 27.3 bits (59), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 114 QYLSQHRPPLALSRCSGAHVLEFLKYLDQFGKTKV 148
           + + QH  PL   R  G +  +  +YLD FG+ +V
Sbjct: 149 ERIRQHYEPLWYYRAVGLYAAQVKRYLDVFGREQV 183


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.136    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,954,180
Number of Sequences: 62578
Number of extensions: 202867
Number of successful extensions: 446
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 444
Number of HSP's gapped (non-prelim): 2
length of query: 247
length of database: 14,973,337
effective HSP length: 96
effective length of query: 151
effective length of database: 8,965,849
effective search space: 1353843199
effective search space used: 1353843199
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)