BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025835
(247 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family
Protein From Arabidopsis Thaliana At3g01520 With Amp
Bound
pdb|2GM3|B Chain B, Crystal Structure Of An Universal Stress Protein Family
Protein From Arabidopsis Thaliana At3g01520 With Amp
Bound
pdb|2GM3|C Chain C, Crystal Structure Of An Universal Stress Protein Family
Protein From Arabidopsis Thaliana At3g01520 With Amp
Bound
pdb|2GM3|D Chain D, Crystal Structure Of An Universal Stress Protein Family
Protein From Arabidopsis Thaliana At3g01520 With Amp
Bound
pdb|2GM3|E Chain E, Crystal Structure Of An Universal Stress Protein Family
Protein From Arabidopsis Thaliana At3g01520 With Amp
Bound
pdb|2GM3|F Chain F, Crystal Structure Of An Universal Stress Protein Family
Protein From Arabidopsis Thaliana At3g01520 With Amp
Bound
Length = 175
Score = 30.4 bits (67), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 3/46 (6%)
Query: 135 VKDHDMKERLCLEVERLGLSAVIMGSRGFGAAKKSSKSRLGSVSDY 180
+K D K+ +C EV+R+ +++GSRG G + K +G+VS +
Sbjct: 107 IKTGDPKDVICQEVKRVRPDFLVVGSRGLG---RFQKVFVGTVSAF 149
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.132 0.384
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,973,339
Number of Sequences: 62578
Number of extensions: 193723
Number of successful extensions: 421
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 419
Number of HSP's gapped (non-prelim): 2
length of query: 247
length of database: 14,973,337
effective HSP length: 96
effective length of query: 151
effective length of database: 8,965,849
effective search space: 1353843199
effective search space used: 1353843199
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)