Citrus Sinensis ID: 025865


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MAIAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICHGFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNVAAGVGAIEGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWVGPLIGGGLAGLIYGNVFMHSEHAPLSNDY
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHEEEcccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccCEEEEHHHHHHHHHHHHHHHHHcccccccccccc
MAIAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICHGFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNVAAGVGAIEGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWVGPLIGGGLAGLIYGNVFMH**********
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICHGFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNVAAGVGAIEGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWVGPLIGGGLAGLIYGNVFMHSEHAPLSNDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable aquaporin TIP2-2 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. May be involved in transport from the vacuolar compartment to the cytoplasm.confidentQ5Z6F0
Aquaporin TIP2-1 Aquaporin required to facilitate the transport of water from the vacuolar compartment to the cytoplasm. Does not promote glycerol permability. Its function is impaired by Hg(2+). Transports urea in yeast cells and Xenopus laevis oocytes in a pH-independent manner. Transports methylammonium or ammonium in yeast cells and Xenopus laevis oocytes, preferentially at high medium pH. May participate in vacuolar compartmentation and detoxification of ammonium.confidentQ41951
Probable aquaporin TIP-type Channel protein in tonoplast. These proteins may allow the diffusion of amino acids and/or peptides from the vacuolar compartment to the cytoplasm.probableP33560

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GD8, chain A
Confidence level:very confident
Coverage over the Query: 14-237
View the alignment between query and template
View the model in PyMOL