Citrus Sinensis ID: 025883


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MEECRPLKCDNRLKRRPLTPIRVFRGLICLLVFFFTAFMFLVYFAPIIAIILRMFSVHHCRKATSFLFGLWLALWPFLFEKINRTTMVFSGDIVPVEERVLLMANHRTEVDWMYVWDLALRKGCLGYIKYILKSSLMKLPVFGWGFHILEFISVERNWEIDEHVMRQMLSTFRNPNDPLWLTIFPEGTDFTEEKRNRSQKFAADVGLPVLTNVLLPKTRGFCLCLETLRNTLDAGFLRCSFSCSYSF
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHcccEEEEccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccEEEEEECc
*************KRRPLTPIRVFRGLICLLVFFFTAFMFLVYFAPIIAIILRMFSVHHCRKATSFLFGLWLALWPFLFEKINRTTMVFSGDIVPVEERVLLMANHRTEVDWMYVWDLALRKGCLGYIKYILKSSLMKLPVFGWGFHILEFISVERNWEIDEHVMRQMLSTFRNPNDPLWLTIFPEGTDFTEEKR****KFAADVGLPVLTNVLLPKTRGFCLCLETLRNTLDAGFLRCSFSCSYSF
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEECRPLKCDNRLKRRPLTPIRVFRGLICLLVFFFTAFMFLVYFAPIIAIILRMFSVHHCRKATSFLFGLWLALWPFLFEKINRTTMVFSGDIVPVEERVLLMANHRTEVDWMYVWDLALRKGCLGYIKYILKSSLMKLPVFGWGFHILEFISVERNWEIDEHVMRQMLSTFRNPNDPLWLTIFPEGTDFTEEKRNRSQKFAADVGLPVLTNVLLPKTRGFCLCLETLRNTLDAGFLRCSFSCSYSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4 May convert lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position (By similarity). Has no activity when expressed in bacteria or yeast.probableQ8L4Y2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IUQ, chain A
Confidence level:confident
Coverage over the Query: 93-214
View the alignment between query and template
View the model in PyMOL