Citrus Sinensis ID: 025900
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| 255560349 | 274 | conserved hypothetical protein [Ricinus | 0.845 | 0.759 | 0.564 | 1e-53 | |
| 224103867 | 288 | predicted protein [Populus trichocarpa] | 0.784 | 0.670 | 0.615 | 2e-53 | |
| 449454989 | 305 | PREDICTED: uncharacterized protein LOC10 | 0.715 | 0.577 | 0.607 | 8e-51 | |
| 449531685 | 270 | PREDICTED: uncharacterized LOC101204259, | 0.715 | 0.651 | 0.607 | 3e-50 | |
| 224059867 | 284 | predicted protein [Populus trichocarpa] | 0.825 | 0.714 | 0.528 | 3e-49 | |
| 359478523 | 314 | PREDICTED: uncharacterized protein LOC10 | 0.853 | 0.668 | 0.504 | 6e-49 | |
| 359386140 | 302 | structural maintenance of chromosomes do | 0.825 | 0.672 | 0.475 | 5e-47 | |
| 357491069 | 286 | hypothetical protein MTR_5g072760 [Medic | 0.735 | 0.632 | 0.535 | 7e-47 | |
| 116782366 | 309 | unknown [Picea sitchensis] gi|116787652| | 0.833 | 0.663 | 0.492 | 3e-46 | |
| 255580849 | 315 | conserved hypothetical protein [Ricinus | 0.833 | 0.650 | 0.473 | 9e-46 |
| >gi|255560349|ref|XP_002521190.1| conserved hypothetical protein [Ricinus communis] gi|223539604|gb|EEF41190.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 215 bits (548), Expect = 1e-53, Method: Compositional matrix adjust.
Identities = 123/218 (56%), Positives = 164/218 (75%), Gaps = 10/218 (4%)
Query: 20 MSGRRVLREPPLSTRALP---PQ---HSPSLHH----LEDRIAIQHSDIQSLLQDNQRLA 69
M+GR L L R +P P+ P LHH LEDRIAIQH +IQ+LL DNQ+L
Sbjct: 1 MAGRNNLPPNTLKHRQVPVDDPRLHNRVPRLHHPSTILEDRIAIQHREIQTLLLDNQQLT 60
Query: 70 ATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELD 129
ATH+ALKQ+L+L + ELRHLS+ AA VKA+RD +VRE+YE+SLKLDAE+R I+++ AEL
Sbjct: 61 ATHLALKQDLALVDDELRHLSAAAADVKAQRDDQVREVYERSLKLDAEVRSIDALRAELV 120
Query: 130 RVRADIEKLCVIKQEMIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIEC 189
+V AD+EKL V +QE+ +L IN D+AKAR E++ +AAI+A+I+T ++EI +GRAAIE
Sbjct: 121 QVTADVEKLSVHRQELTAELRAINSDVAKARTEAQQVAAIEADIQTMQKEIQRGRAAIEN 180
Query: 190 EKKNRASNHEQREIMEKNIISVAQQIERLQAELANAEK 227
EKK ASN E + ME+N+I+VA++IE+L AELAN EK
Sbjct: 181 EKKLYASNLEHGQTMEQNMIAVAREIEKLHAELANLEK 218
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224103867|ref|XP_002313225.1| predicted protein [Populus trichocarpa] gi|222849633|gb|EEE87180.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449454989|ref|XP_004145236.1| PREDICTED: uncharacterized protein LOC101204475 [Cucumis sativus] gi|449471289|ref|XP_004153266.1| PREDICTED: uncharacterized protein LOC101204259 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449531685|ref|XP_004172816.1| PREDICTED: uncharacterized LOC101204259, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224059867|ref|XP_002300004.1| predicted protein [Populus trichocarpa] gi|222847262|gb|EEE84809.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359478523|ref|XP_002278199.2| PREDICTED: uncharacterized protein LOC100258756 [Vitis vinifera] gi|297745841|emb|CBI15897.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359386140|gb|AEV43359.1| structural maintenance of chromosomes domain-containing protein [Citrus sinensis] | Back alignment and taxonomy information |
|---|
| >gi|357491069|ref|XP_003615822.1| hypothetical protein MTR_5g072760 [Medicago truncatula] gi|355517157|gb|AES98780.1| hypothetical protein MTR_5g072760 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|116782366|gb|ABK22481.1| unknown [Picea sitchensis] gi|116787652|gb|ABK24593.1| unknown [Picea sitchensis] gi|116793930|gb|ABK26936.1| unknown [Picea sitchensis] gi|224286832|gb|ACN41119.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|255580849|ref|XP_002531244.1| conserved hypothetical protein [Ricinus communis] gi|223529163|gb|EEF31141.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| TAIR|locus:2089616 | 331 | AT3G14750 "AT3G14750" [Arabido | 0.768 | 0.570 | 0.425 | 3.4e-38 | |
| TAIR|locus:2060848 | 288 | AT2G30120 [Arabidopsis thalian | 0.699 | 0.597 | 0.494 | 1.1e-37 | |
| TAIR|locus:2035751 | 283 | AT1G55170 "AT1G55170" [Arabido | 0.853 | 0.742 | 0.339 | 1.6e-29 | |
| TAIR|locus:2033681 | 359 | AT1G67170 "AT1G67170" [Arabido | 0.776 | 0.532 | 0.321 | 7.3e-27 | |
| TAIR|locus:2156146 | 238 | AT5G61920 "AT5G61920" [Arabido | 0.731 | 0.756 | 0.276 | 6.7e-17 | |
| FB|FBgn0264695 | 1962 | Mhc "Myosin heavy chain" [Dros | 0.678 | 0.085 | 0.251 | 2.9e-06 | |
| ASPGD|ASPL0000061296 | 1258 | AN0317 [Emericella nidulans (t | 0.715 | 0.139 | 0.276 | 2e-05 | |
| WB|WBGene00003515 | 1969 | myo-3 [Caenorhabditis elegans | 0.686 | 0.085 | 0.254 | 2.6e-05 | |
| UNIPROTKB|P12844 | 1969 | myo-3 "Myosin-3" [Caenorhabdit | 0.686 | 0.085 | 0.254 | 2.6e-05 | |
| UNIPROTKB|A7E2Y1 | 1941 | MYH7B "Myosin-7B" [Homo sapien | 0.686 | 0.087 | 0.269 | 3.3e-05 |
| TAIR|locus:2089616 AT3G14750 "AT3G14750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 409 (149.0 bits), Expect = 3.4e-38, P = 3.4e-38
Identities = 83/195 (42%), Positives = 133/195 (68%)
Query: 27 REPP--LSTRALPPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQ 84
REP + R LPPQ S LEDR+A Q+ D+Q LL DNQRLAATHVALKQEL +A+
Sbjct: 52 REPQFRVDARGLPPQFSI----LEDRLAAQNQDVQGLLADNQRLAATHVALKQELEVAQH 107
Query: 85 ELRHLSSVAASVKAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQE 144
EL+ + S++AE + +RE+Y+KS++ + ELR +++M AE+ ++RADI++ +QE
Sbjct: 108 ELQRIMHYIDSLRAEEEIMMREMYDKSMRSEMELREVDAMRAEIQKIRADIKEFTSGRQE 167
Query: 145 MIKDLNEINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIM 204
+ ++ + DLA+ + + + + AEIE +QE+ + RAAI+ EKK A N+E +IM
Sbjct: 168 LTSQVHLMTQDLARLTADLQQIPTLTAEIENTKQELQRARAAIDYEKKGYAENYEHGKIM 227
Query: 205 EKNIISVAQQIERLQ 219
E ++++A+++E+L+
Sbjct: 228 EHKLVAMARELEKLR 242
|
|
| TAIR|locus:2060848 AT2G30120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035751 AT1G55170 "AT1G55170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033681 AT1G67170 "AT1G67170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156146 AT5G61920 "AT5G61920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0264695 Mhc "Myosin heavy chain" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000061296 AN0317 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003515 myo-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P12844 myo-3 "Myosin-3" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7E2Y1 MYH7B "Myosin-7B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| pfam08317 | 321 | pfam08317, Spc7, Spc7 kinetochore protein | 5e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 6e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 0.002 |
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Score = 50.1 bits (120), Expect = 5e-07
Identities = 48/211 (22%), Positives = 89/211 (42%), Gaps = 15/211 (7%)
Query: 37 PPQHSPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASV 96
L L +R+ ++ SL + +R+ L QELS A +++ + +
Sbjct: 669 SRSEPAELQRLRERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEKEIEQL 728
Query: 97 KAERDAEVRELYEKSLKLDAELRVIESMHAELDRVRADIEKLCVIKQEMIKDLN------ 150
+ E + L E L + + IE++ +EL + A IE+L ++ + LN
Sbjct: 729 EQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEELEEDLHKLEEALNDLEARL 788
Query: 151 ------EINGDLAKARDESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIM 204
EI +L+K +E + A EIE + + + +E E + EQR +
Sbjct: 789 SHSRIPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEIQEL---QEQRIDL 845
Query: 205 EKNIISVAQQIERLQAELANAEKRARAAAAA 235
++ I S+ ++IE L + E+ AA
Sbjct: 846 KEQIKSIEKEIENLNGKKEELEEELEELEAA 876
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1164 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.79 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.71 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.63 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.56 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.43 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.39 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.15 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.13 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.11 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.05 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.04 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.93 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.89 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.84 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.81 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.78 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.74 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.57 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.57 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 96.44 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.37 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 96.32 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.2 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.18 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.04 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 95.97 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.97 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.91 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.9 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.83 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.76 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 95.66 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.62 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 95.54 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 95.38 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 95.23 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.9 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 94.82 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 94.82 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 94.8 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 94.62 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 94.6 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 94.57 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 94.5 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.37 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.3 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.15 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.1 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.07 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 93.89 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 93.86 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 93.83 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 93.81 | |
| PF13514 | 1111 | AAA_27: AAA domain | 93.72 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 93.62 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.52 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 93.45 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 93.39 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 93.21 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 92.93 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 92.85 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 92.84 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 92.64 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 92.64 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 92.56 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 92.54 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 92.43 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.43 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 92.4 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 92.4 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 92.29 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 92.22 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.22 | |
| PRK09039 | 343 | hypothetical protein; Validated | 92.2 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 92.15 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 91.98 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 91.88 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 91.62 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.6 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 91.59 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 91.38 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 91.21 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 91.08 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 90.98 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 90.81 | |
| PRK11546 | 143 | zraP zinc resistance protein; Provisional | 90.74 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 90.67 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 90.34 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 90.18 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 89.98 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 89.83 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 89.55 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.43 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 89.16 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 88.94 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 88.86 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 88.85 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 88.79 | |
| KOG3478 | 120 | consensus Prefoldin subunit 6, KE2 family [Posttra | 88.73 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 88.63 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 88.6 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 88.6 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 88.5 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 88.38 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 88.01 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 87.93 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 87.41 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 87.04 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 86.41 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 86.28 | |
| PF12592 | 57 | DUF3763: Protein of unknown function (DUF3763); In | 86.22 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 86.2 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 86.19 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 86.1 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 86.01 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 85.82 | |
| PF13514 | 1111 | AAA_27: AAA domain | 85.53 | |
| PF07794 | 790 | DUF1633: Protein of unknown function (DUF1633); In | 85.16 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 85.07 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 84.91 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 84.61 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 84.49 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 84.34 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 84.32 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 84.22 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 84.17 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 84.14 | |
| PF08912 | 69 | Rho_Binding: Rho Binding; InterPro: IPR015008 Rho | 84.02 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 84.0 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 83.92 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 83.86 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 83.29 | |
| PF14817 | 632 | HAUS5: HAUS augmin-like complex subunit 5 | 83.27 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 83.09 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 82.98 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 82.94 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 82.67 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 82.67 | |
| PF05837 | 106 | CENP-H: Centromere protein H (CENP-H); InterPro: I | 82.57 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 82.56 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 82.53 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 82.47 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 82.3 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 82.17 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 82.06 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 82.0 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 81.78 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 81.77 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 81.7 | |
| PF11221 | 144 | Med21: Subunit 21 of Mediator complex; InterPro: I | 81.69 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 81.15 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 80.87 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 80.72 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 80.6 | |
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 80.48 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 80.4 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 80.29 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 80.25 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 80.01 |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Probab=97.79 E-value=0.017 Score=59.31 Aligned_cols=80 Identities=13% Similarity=0.142 Sum_probs=40.5
Q ss_pred CCccccccccCCCCCCCCCCCCC-CCchHhHHHHHHhhHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q 025900 18 FTMSGRRVLREPPLSTRALPPQH-SPSLHHLEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASV 96 (246)
Q Consensus 18 ~~~~~r~~~~~~~~~~~~~p~p~-~p~~~~LEe~La~Q~~EiqrLl~dNqRLAatHvaLrQeL~aaq~El~~l~~~i~~i 96 (246)
-|.+|=.+.+.|.++.|....+. .........+|.....++..|-.+-..+-.....+.+++...+.++..+...+..+
T Consensus 642 vTldG~~~~~~G~~tgG~~~~~~~~~~~~~~~~~l~~l~~~l~~l~~~l~~l~~~~~~~~~~l~~l~~~~~~~~~~~~~l 721 (1164)
T TIGR02169 642 VTLEGELFEKSGAMTGGSRAPRGGILFSRSEPAELQRLRERLEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEI 721 (1164)
T ss_pred EEeCceeEcCCcCccCCCCCCCCCcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45666666666666655421110 00000113455555566666665555555555555666655555555554444444
Q ss_pred h
Q 025900 97 K 97 (246)
Q Consensus 97 ~ 97 (246)
+
T Consensus 722 ~ 722 (1164)
T TIGR02169 722 E 722 (1164)
T ss_pred H
Confidence 3
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. |
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11546 zraP zinc resistance protein; Provisional | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF12592 DUF3763: Protein of unknown function (DUF3763); InterPro: IPR022547 This domain is found in bacterial regulartory ATPases 3 | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF07794 DUF1633: Protein of unknown function (DUF1633); InterPro: IPR012436 This family contains sequences derived from a group of hypothetical proteins expressed by Arabidopsis thaliana (Mouse-ear cress) | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF08912 Rho_Binding: Rho Binding; InterPro: IPR015008 Rho is responsible for the recognition and binding of Rho binding domain-containing proteins (such as ROCK) to Rho, resulting in activation of the GTPase which in turn modulates the phosphorylation of various signalling proteins | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF14817 HAUS5: HAUS augmin-like complex subunit 5 | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF11221 Med21: Subunit 21 of Mediator complex; InterPro: IPR021384 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-07 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 5e-05 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 56.4 bits (136), Expect = 2e-09
Identities = 34/186 (18%), Positives = 72/186 (38%), Gaps = 6/186 (3%)
Query: 47 LEDRIAIQHSDIQSLLQDNQRLAATHVALKQELSLAEQELRHLSSVAASVKAERDAEVRE 106
+ED I I L ++ + L L L+ E++ ++L+ + ++ E+
Sbjct: 988 MEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMIS-ELEV 1046
Query: 107 LYEKSLKLDAEL-RVIESMHAELDRVRADIEKLCVIKQEMIKDL----NEINGDLAKARD 161
+K K EL ++ + E + I +L E+ L E+ LA+ D
Sbjct: 1047 RLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLED 1106
Query: 162 ESKDMAAIKAEIETERQEIHKGRAAIECEKKNRASNHEQREIMEKNIISVAQQIERLQAE 221
E+ +I I + +E EK R +Q+ + + + ++ ++E
Sbjct: 1107 ETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDT 1166
Query: 222 LANAEK 227
A ++
Sbjct: 1167 TATQQE 1172
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 97.33 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.51 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 96.34 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.3 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.3 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.79 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.74 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.7 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.59 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 94.27 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 93.83 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 93.07 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 92.39 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 92.03 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 91.96 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 91.06 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 90.64 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 90.38 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 88.76 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 88.65 | |
| 1ykh_B | 132 | RNA polymerase II holoenzyme component SRB7; gene | 88.35 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 88.07 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 88.06 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 87.77 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 87.65 | |
| 1yke_B | 151 | RNA polymerase II holoenzyme component SRB7; gene | 87.59 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 87.04 | |
| 3lay_A | 175 | Zinc resistance-associated protein; salmonella typ | 86.01 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 85.77 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 85.33 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 83.95 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 82.59 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 82.46 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 82.28 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 82.1 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 81.9 | |
| 4e61_A | 106 | Protein BIM1; EB1-like motif, coiled-coil, spindle | 81.11 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 81.02 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 80.99 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 80.91 | |
| 4fla_A | 152 | Regulation of nuclear PRE-mRNA domain-containing 1 | 80.73 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 80.03 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=97.33 E-value=0.042 Score=44.03 Aligned_cols=7 Identities=14% Similarity=0.121 Sum_probs=2.5
Q ss_pred HHHHHHH
Q 025900 55 HSDIQSL 61 (246)
Q Consensus 55 ~~EiqrL 61 (246)
..+|..+
T Consensus 12 ~~~~~~~ 18 (284)
T 1c1g_A 12 KLDKENA 18 (284)
T ss_dssp HHHHHHH
T ss_pred HHhHHHH
Confidence 3333333
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >1ykh_B RNA polymerase II holoenzyme component SRB7; gene regulation; 3.00A {Saccharomyces cerevisiae} SCOP: a.252.1.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1yke_B RNA polymerase II holoenzyme component SRB7; gene regulation; 3.30A {Saccharomyces cerevisiae} SCOP: a.252.1.1 | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >4e61_A Protein BIM1; EB1-like motif, coiled-coil, spindle orientation, mitosis, K phosphorylation, mitotic spindle, microtubules, cell cycle; 2.45A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00