BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025917
         (246 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LYH|A Chain A, Crystal Structure Of Putative Cobalamin (Vitamin B12)
           Biosynthesis Cbix Protein (Yp_958415.1) From
           Marinobacter Aquaeolei Vt8 At 1.60 A Resolution
 pdb|3LYH|B Chain B, Crystal Structure Of Putative Cobalamin (Vitamin B12)
           Biosynthesis Cbix Protein (Yp_958415.1) From
           Marinobacter Aquaeolei Vt8 At 1.60 A Resolution
          Length = 126

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 164 AHMELAEPSIKDAFGSCVQQGANRVIVSPFFLFPGRHWCQDIPSLTAEAAKEHPGVPYIV 223
           A+ ELAEPS+         QG  +  V P FL  GRH  +D+P+       EH GV   +
Sbjct: 41  AYXELAEPSLDTIVNRAKGQGVEQFTVVPLFLAAGRHLRKDVPAXIERLEAEH-GVTIRL 99

Query: 224 TAPLG 228
             P+G
Sbjct: 100 AEPIG 104


>pdb|2JH3|A Chain A, The Crystal Structure Of Dr2241 From Deinococcus
           Radiodurans At 1.9 A Resolution Reveals A Multi-Domain
           Protein With Structural Similarity To Chelatases But
           Also With Two Additional Novel Domains
 pdb|2JH3|B Chain B, The Crystal Structure Of Dr2241 From Deinococcus
           Radiodurans At 1.9 A Resolution Reveals A Multi-Domain
           Protein With Structural Similarity To Chelatases But
           Also With Two Additional Novel Domains
 pdb|2JH3|C Chain C, The Crystal Structure Of Dr2241 From Deinococcus
           Radiodurans At 1.9 A Resolution Reveals A Multi-Domain
           Protein With Structural Similarity To Chelatases But
           Also With Two Additional Novel Domains
 pdb|2JH3|D Chain D, The Crystal Structure Of Dr2241 From Deinococcus
           Radiodurans At 1.9 A Resolution Reveals A Multi-Domain
           Protein With Structural Similarity To Chelatases But
           Also With Two Additional Novel Domains
          Length = 474

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 185 ANRVIVSPFFLFPGRHWCQDIPSLTAEAAKEHPGVPYI-VTAPLGLHEQLVVNNFVLSFA 243
           A + ++ PF    G+H  + +    A+AA+  P  P + V  P+G H    V   VL+ A
Sbjct: 204 AGQAVLVPFLTHLGKHAAERLQQALAQAAERFPQAPPLHVGGPVGEHP--AVAEVVLALA 261


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.133    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,094,549
Number of Sequences: 62578
Number of extensions: 263467
Number of successful extensions: 433
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 432
Number of HSP's gapped (non-prelim): 3
length of query: 246
length of database: 14,973,337
effective HSP length: 96
effective length of query: 150
effective length of database: 8,965,849
effective search space: 1344877350
effective search space used: 1344877350
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)