BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025951
         (245 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P31973|FENR_SYNP2 Ferredoxin--NADP reductase OS=Synechococcus sp. (strain ATCC 27264
           / PCC 7002 / PR-6) GN=petH PE=1 SV=1
          Length = 402

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 84  GSDTKLGFPSGENSSLPVAIFNGPEPFRGKSGSVSFCGLTHQLVEEG 130
            S TK+  P   ++S+PV I+    PF GK      C   ++LV+EG
Sbjct: 97  ASSTKIVHPKTTDTSVPVNIYRPKTPFLGK------CIENYELVDEG 137


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.322    0.137    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 93,308,565
Number of Sequences: 539616
Number of extensions: 3961759
Number of successful extensions: 7674
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 7672
Number of HSP's gapped (non-prelim): 8
length of query: 245
length of database: 191,569,459
effective HSP length: 114
effective length of query: 131
effective length of database: 130,053,235
effective search space: 17036973785
effective search space used: 17036973785
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)