Citrus Sinensis ID: 025953


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MAGIGASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRYIRFCRFHRAARCWKSWFGYSSRQDFSCTWNCAYLCISIHHFLPRASREVVPVVPCELVLKIPDFVDLNPCVTVGEIEFLKNCQHASQMAKGEQSL
ccccccccccccccccccccEEEEEccccccccccHHHHHHHHHccccCECcHHHHHHHHHccccEEEECccHHHHHHccccccccccEEEccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccCEEEEccccccHHHHHHHHHccccCEEEEcccccccccccccccEEEEEEEcccccccccCEEECccEEEEEccccccccccCEEEEHHHHcccHHHHHHHHccccc
***************KLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRYIRFCRFHRAARCWKSWFGYSSRQDFSCTWNCAYLCISIHHFLPRASREVVPVVPCELVLKIPDFVDLNPCVTVGEIEFLKNCQH***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGIGASCSFLPSRSKLRTTWLQFETHPGRKVSGKSICRRNLKIRADVNYVNAEEAKNLIAVERYAVLDVRDNSQYNRAHIKSSYHVPLFIENQDNDLGTIIKRTVHNNFSGLFFGLPFTKQNPEFVQSVKSQFSPESKLLVVCQEGLRYIRFCRFHRAARCWKSWFGYSSRQDFSCTWNCAYLCISIHHFLPRASREVVPVVPCELVLKIPDFVDLNPCVTVGEIEFLKNCQHASQMAKGEQSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rhodanese-like domain-containing protein 9, chloroplastic probableO48529

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OP3, chain A
Confidence level:very confident
Coverage over the Query: 46-103,117-120,133-194
View the alignment between query and template
View the model in PyMOL
Template: 3G5J, chain A
Confidence level:confident
Coverage over the Query: 49-162,180-194
View the alignment between query and template
View the model in PyMOL
Template: 2J6P, chain A
Confidence level:confident
Coverage over the Query: 47-98,124-231
View the alignment between query and template
View the model in PyMOL