Citrus Sinensis ID: 025973


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MEPEVANQGNEISPNNTIYINNLNEKVKIDQLKQSLHAVFKQFGTILEILAFKTLKHKGQAWLVFKDVASATAAVEKMQGFPFYDKPMRIQYAKTKSDIIAKADGTFVPRERRKRHEEKGKKRKDQHDANQAGMGLNPAYAGAYGATPPLSQIPYPGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLLITYAKK
ccccccccccccccccEEEEccccccccHHHHHHHHHHHHcccccEEEEEEccccccEEEEEEEEccHHHHHHHHHHccccccccccCEEcccccccHHHHHcccccccHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccccccccccccCEEEEccccccccHHHHHHHHcccccCEEEEEEcccccEEEEEEccHHHHHHHHHHHcccEEcccEEEEEEEEc
***************NTIYINNLNEKVKIDQLKQSLHAVFKQFGTILEILAFKTLKHKGQAWLVFKDVASATAAVEKMQGFPFYDKPMRIQYAKTKSDIIAKA*************************************AGAYGATPPLSQIPYPGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLLITYAKK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPEVANQGNEISPNNTIYINNLNEKVKIDQLKQSLHAVFKQFGTILEILAFKTLKHKGQAWLVFKDVASATAAVEKMQGFPFYDKPMRIQYAKTKSDIIAKADGTFVPRERRKRHEEKGKKRKDQHDANQAGMGLNPAYAGAYGATPPLSQIPYPGGAKSVIPEAPAPPNNILFVQNVPHDTTPMALQMFFSQFPGFKEVRMVEAKPGIAFVEYGDEMQATVAMQSLQSLKIGQQQLLITYAKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U1 small nuclear ribonucleoprotein A Involved in nuclear pre-mRNA splicing (By similarity). Seems to not be involved in polyadenylation.confidentQ39244
U1 small nuclear ribonucleoprotein A Involved in nuclear pre-mRNA splicing.probableQ0DKM4
U1 small nuclear ribonucleoprotein A Binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. Binds preferentially to the 5'-UGCAC-3' motif in vitro.probableQ62189

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 11-108
View the alignment between query and template
View the model in PyMOL