BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025975
         (245 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CWB|D Chain D, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated
           Analogue Of The Polyketide Crocacin-d
 pdb|3CWB|Q Chain Q, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated
           Analogue Of The Polyketide Crocacin-d
 pdb|3H1H|D Chain D, Cytochrome Bc1 Complex From Chicken
 pdb|3H1H|Q Chain Q, Cytochrome Bc1 Complex From Chicken
 pdb|3H1I|D Chain D, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex
           From Chicken
 pdb|3H1I|Q Chain Q, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex
           From Chicken
 pdb|3H1J|D Chain D, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
 pdb|3H1J|Q Chain Q, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
 pdb|3H1K|D Chain D, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated
           Derivative Of Kresoxim-Methyl Bound
 pdb|3H1K|Q Chain Q, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated
           Derivative Of Kresoxim-Methyl Bound
 pdb|3H1L|D Chain D, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound At
           Qo And Qi Sites
 pdb|3H1L|Q Chain Q, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound At
           Qo And Qi Sites
 pdb|3L70|D Chain D, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin
           Bound
 pdb|3L70|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin
           Bound
 pdb|3L71|D Chain D, Cytochrome Bc1 Complex From Chicken With Azoxystrobin
           Bound
 pdb|3L71|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Azoxystrobin
           Bound
 pdb|3L72|D Chain D, Chicken Cytochrome Bc1 Complex With Kresoxym-I-Dimethyl
           Bound
 pdb|3L72|Q Chain Q, Chicken Cytochrome Bc1 Complex With Kresoxym-I-Dimethyl
           Bound
 pdb|3L73|D Chain D, Cytochrome Bc1 Complex From Chicken With Triazolone
           Inhibitor
 pdb|3L73|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Triazolone
           Inhibitor
 pdb|3L74|D Chain D, Cytochrome Bc1 Complex From Chicken With Famoxadone Bound
 pdb|3L74|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Famoxadone Bound
 pdb|3L75|D Chain D, Cytochrome Bc1 Complex From Chicken With Fenamidone Bound
 pdb|3L75|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Fenamidone Bound
 pdb|3TGU|D Chain D, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed Moa
           Inhibitor Bound
 pdb|3TGU|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed Moa
           Inhibitor Bound
          Length = 241

 Score = 31.2 bits (69), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 212 VKYGPYFLGSLVGMVPEIFVTIYTYVFGLPILFT 245
           + Y PYF G  +GM P I+  I  Y  G P   +
Sbjct: 147 LHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMS 180


>pdb|1BCC|D Chain D, Cytochrome Bc1 Complex From Chicken
 pdb|3BCC|D Chain D, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex
           From Chicken
 pdb|2BCC|D Chain D, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
          Length = 241

 Score = 29.3 bits (64), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 6/51 (11%)

Query: 201 IIYNYCAVATHVK------YGPYFLGSLVGMVPEIFVTIYTYVFGLPILFT 245
           ++  YC   T V       + PYF G  +GM P I+  +  +  G P   +
Sbjct: 130 LLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMS 180


>pdb|1BGY|D Chain D, Cytochrome Bc1 Complex From Bovine
 pdb|1BGY|P Chain P, Cytochrome Bc1 Complex From Bovine
 pdb|1BE3|D Chain D, Cytochrome Bc1 Complex From Bovine
 pdb|1L0L|D Chain D, Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex
           With A Bound Fungicide Famoxadone
 pdb|1L0N|D Chain D, Native Structure Of Bovine Mitochondrial Cytochrome Bc1
           Complex
 pdb|1NTK|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1 In
           Complex With Antimycin A1
 pdb|1NTM|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1 Complex
           At 2.4 Angstrom
 pdb|1NTZ|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1 Complex
           Bound With Ubiquinone
 pdb|1NU1|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1
           Complexed With 2- Nonyl-4-Hydroxyquinoline N-Oxide
           (Nqno)
 pdb|1PP9|D Chain D, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
 pdb|1PP9|Q Chain Q, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
 pdb|1PPJ|D Chain D, Bovine Cytochrome Bc1 Complex With Stigmatellin And
           Antimycin
 pdb|1PPJ|Q Chain Q, Bovine Cytochrome Bc1 Complex With Stigmatellin And
           Antimycin
 pdb|1SQB|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin
 pdb|2A06|D Chain D, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
 pdb|2A06|Q Chain Q, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
 pdb|1SQV|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Uhdbt
 pdb|1SQX|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Stigmatellin
           A
 pdb|1SQP|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Myxothiazol
 pdb|1SQQ|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Methoxy
           Acrylate Stilbene (Moas)
 pdb|2FYU|D Chain D, Crystal Structure Of Bovine Heart Mitochondrial Bc1 With
           Jg144 Inhibitor
 pdb|2YBB|D Chain D, Fitted Model For Bovine  Mitochondrial Supercomplex
           I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
 pdb|2YBB|DD Chain d, Fitted Model For Bovine  Mitochondrial Supercomplex
           I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
          Length = 241

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 6/51 (11%)

Query: 201 IIYNYCAVATHVK------YGPYFLGSLVGMVPEIFVTIYTYVFGLPILFT 245
           ++  YC   T V       + PYF G  +GM P I+  +  +  G P   +
Sbjct: 130 LLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMS 180


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.144    0.479 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,742,640
Number of Sequences: 62578
Number of extensions: 310140
Number of successful extensions: 491
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 488
Number of HSP's gapped (non-prelim): 5
length of query: 245
length of database: 14,973,337
effective HSP length: 96
effective length of query: 149
effective length of database: 8,965,849
effective search space: 1335911501
effective search space used: 1335911501
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)