BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025975
(245 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CWB|D Chain D, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated
Analogue Of The Polyketide Crocacin-d
pdb|3CWB|Q Chain Q, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated
Analogue Of The Polyketide Crocacin-d
pdb|3H1H|D Chain D, Cytochrome Bc1 Complex From Chicken
pdb|3H1H|Q Chain Q, Cytochrome Bc1 Complex From Chicken
pdb|3H1I|D Chain D, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex
From Chicken
pdb|3H1I|Q Chain Q, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex
From Chicken
pdb|3H1J|D Chain D, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
pdb|3H1J|Q Chain Q, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
pdb|3H1K|D Chain D, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated
Derivative Of Kresoxim-Methyl Bound
pdb|3H1K|Q Chain Q, Chicken Cytochrome Bc1 Complex With Zn++ And An Iodinated
Derivative Of Kresoxim-Methyl Bound
pdb|3H1L|D Chain D, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound At
Qo And Qi Sites
pdb|3H1L|Q Chain Q, Chicken Cytochrome Bc1 Complex With Ascochlorin Bound At
Qo And Qi Sites
pdb|3L70|D Chain D, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin
Bound
pdb|3L70|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Trifloxystrobin
Bound
pdb|3L71|D Chain D, Cytochrome Bc1 Complex From Chicken With Azoxystrobin
Bound
pdb|3L71|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Azoxystrobin
Bound
pdb|3L72|D Chain D, Chicken Cytochrome Bc1 Complex With Kresoxym-I-Dimethyl
Bound
pdb|3L72|Q Chain Q, Chicken Cytochrome Bc1 Complex With Kresoxym-I-Dimethyl
Bound
pdb|3L73|D Chain D, Cytochrome Bc1 Complex From Chicken With Triazolone
Inhibitor
pdb|3L73|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Triazolone
Inhibitor
pdb|3L74|D Chain D, Cytochrome Bc1 Complex From Chicken With Famoxadone Bound
pdb|3L74|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Famoxadone Bound
pdb|3L75|D Chain D, Cytochrome Bc1 Complex From Chicken With Fenamidone Bound
pdb|3L75|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Fenamidone Bound
pdb|3TGU|D Chain D, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed Moa
Inhibitor Bound
pdb|3TGU|Q Chain Q, Cytochrome Bc1 Complex From Chicken With Pfvs-Designed Moa
Inhibitor Bound
Length = 241
Score = 31.2 bits (69), Expect = 0.61, Method: Compositional matrix adjust.
Identities = 13/34 (38%), Positives = 17/34 (50%)
Query: 212 VKYGPYFLGSLVGMVPEIFVTIYTYVFGLPILFT 245
+ Y PYF G +GM P I+ I Y G P +
Sbjct: 147 LHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMS 180
>pdb|1BCC|D Chain D, Cytochrome Bc1 Complex From Chicken
pdb|3BCC|D Chain D, Stigmatellin And Antimycin Bound Cytochrome Bc1 Complex
From Chicken
pdb|2BCC|D Chain D, Stigmatellin-Bound Cytochrome Bc1 Complex From Chicken
Length = 241
Score = 29.3 bits (64), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 6/51 (11%)
Query: 201 IIYNYCAVATHVK------YGPYFLGSLVGMVPEIFVTIYTYVFGLPILFT 245
++ YC T V + PYF G +GM P I+ + + G P +
Sbjct: 130 LLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMS 180
>pdb|1BGY|D Chain D, Cytochrome Bc1 Complex From Bovine
pdb|1BGY|P Chain P, Cytochrome Bc1 Complex From Bovine
pdb|1BE3|D Chain D, Cytochrome Bc1 Complex From Bovine
pdb|1L0L|D Chain D, Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex
With A Bound Fungicide Famoxadone
pdb|1L0N|D Chain D, Native Structure Of Bovine Mitochondrial Cytochrome Bc1
Complex
pdb|1NTK|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1 In
Complex With Antimycin A1
pdb|1NTM|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1 Complex
At 2.4 Angstrom
pdb|1NTZ|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1 Complex
Bound With Ubiquinone
pdb|1NU1|D Chain D, Crystal Structure Of Mitochondrial Cytochrome Bc1
Complexed With 2- Nonyl-4-Hydroxyquinoline N-Oxide
(Nqno)
pdb|1PP9|D Chain D, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
pdb|1PP9|Q Chain Q, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
pdb|1PPJ|D Chain D, Bovine Cytochrome Bc1 Complex With Stigmatellin And
Antimycin
pdb|1PPJ|Q Chain Q, Bovine Cytochrome Bc1 Complex With Stigmatellin And
Antimycin
pdb|1SQB|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Azoxystrobin
pdb|2A06|D Chain D, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
pdb|2A06|Q Chain Q, Bovine Cytochrome Bc1 Complex With Stigmatellin Bound
pdb|1SQV|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Uhdbt
pdb|1SQX|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Stigmatellin
A
pdb|1SQP|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Myxothiazol
pdb|1SQQ|D Chain D, Crystal Structure Analysis Of Bovine Bc1 With Methoxy
Acrylate Stilbene (Moas)
pdb|2FYU|D Chain D, Crystal Structure Of Bovine Heart Mitochondrial Bc1 With
Jg144 Inhibitor
pdb|2YBB|D Chain D, Fitted Model For Bovine Mitochondrial Supercomplex
I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
pdb|2YBB|DD Chain d, Fitted Model For Bovine Mitochondrial Supercomplex
I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
Length = 241
Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 6/51 (11%)
Query: 201 IIYNYCAVATHVK------YGPYFLGSLVGMVPEIFVTIYTYVFGLPILFT 245
++ YC T V + PYF G +GM P I+ + + G P +
Sbjct: 130 LLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMS 180
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.144 0.479
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,742,640
Number of Sequences: 62578
Number of extensions: 310140
Number of successful extensions: 491
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 488
Number of HSP's gapped (non-prelim): 5
length of query: 245
length of database: 14,973,337
effective HSP length: 96
effective length of query: 149
effective length of database: 8,965,849
effective search space: 1335911501
effective search space used: 1335911501
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)