Query         026009
Match_columns 245
No_of_seqs    114 out of 333
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 02:38:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026009.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026009hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3092 Casein kinase II, beta 100.0 1.1E-95  2E-100  633.1  14.3  192   53-244     3-194 (216)
  2 PTZ00396 Casein kinase II subu 100.0 2.5E-91 5.5E-96  628.0  16.6  204   42-245     5-209 (251)
  3 PF01214 CK_II_beta:  Casein ki 100.0   1E-88 2.2E-93  587.8   8.9  184   58-241     1-184 (184)
  4 COG5041 SKB2 Casein kinase II, 100.0 9.8E-86 2.1E-90  575.4   9.9  188   55-244    22-209 (242)
  5 PRK05978 hypothetical protein;  82.3     1.4   3E-05   37.7   3.2   42  147-197    24-65  (148)
  6 PF01927 Mut7-C:  Mut7-C RNAse   75.1     2.9 6.2E-05   34.8   2.9   41  153-196    88-136 (147)
  7 COG1656 Uncharacterized conser  71.3     4.2 9.1E-05   35.5   3.1   62  133-197    66-143 (165)
  8 KOG4684 Uncharacterized conser  50.7      14 0.00031   34.0   2.8   36  159-194   141-180 (275)
  9 smart00647 IBR In Between Ring  50.3      25 0.00055   24.0   3.5   23  147-169     7-31  (64)
 10 PF14205 Cys_rich_KTR:  Cystein  48.9     7.5 0.00016   28.2   0.6   11  182-192    26-36  (55)
 11 PF06044 DRP:  Dam-replacing fa  46.8     4.3 9.3E-05   37.6  -1.1   58  157-221    32-101 (254)
 12 PF06677 Auto_anti-p27:  Sjogre  45.9      17 0.00037   24.7   1.9   23  158-191    19-41  (41)
 13 PRK00420 hypothetical protein;  45.2      24 0.00052   28.9   3.1   30  157-197    24-53  (112)
 14 PF05191 ADK_lid:  Adenylate ki  44.5      14 0.00031   24.2   1.4   13  184-196     1-13  (36)
 15 PF06827 zf-FPG_IleRS:  Zinc fi  43.8      10 0.00023   23.3   0.6   10  184-193    21-30  (30)
 16 TIGR02098 MJ0042_CXXC MJ0042 f  43.2      12 0.00025   24.0   0.8   28  164-194     8-35  (38)
 17 COG2888 Predicted Zn-ribbon RN  39.9      19  0.0004   26.7   1.5   17  177-193    20-36  (61)
 18 PRK00432 30S ribosomal protein  39.8      14  0.0003   25.9   0.8   10  183-192    19-28  (50)
 19 PF08772 NOB1_Zn_bind:  Nin one  39.6      11 0.00024   28.6   0.3   13  181-193    21-33  (73)
 20 COG0401 Uncharacterized homolo  37.9     9.7 0.00021   27.7  -0.2   13  129-141    43-55  (56)
 21 PF03811 Zn_Tnp_IS1:  InsA N-te  36.4      20 0.00043   23.6   1.1   12  181-192     2-13  (36)
 22 PF11238 DUF3039:  Protein of u  35.3     9.2  0.0002   28.1  -0.7   28  161-195    28-55  (58)
 23 PF13717 zinc_ribbon_4:  zinc-r  34.6      24 0.00051   23.0   1.2   15  183-197     1-15  (36)
 24 COG4416 Com Mu-like prophage p  34.1      19 0.00042   26.3   0.8   17  178-194    18-34  (60)
 25 PF10601 zf-LITAF-like:  LITAF-  34.0      25 0.00055   25.7   1.5   19  179-197     2-20  (73)
 26 PF13719 zinc_ribbon_5:  zinc-r  33.7      20 0.00044   23.3   0.8   29  164-195     8-36  (37)
 27 KOG0435 Leucyl-tRNA synthetase  33.4      26 0.00056   37.2   1.9   57  153-213   427-502 (876)
 28 PF09788 Tmemb_55A:  Transmembr  32.9      38 0.00082   31.6   2.7   37  159-195   126-168 (256)
 29 COG5034 TNG2 Chromatin remodel  32.1      28 0.00061   32.6   1.7   39  150-193   225-270 (271)
 30 KOG1973 Chromatin remodeling p  31.5      25 0.00055   32.4   1.3   38  152-192   228-267 (274)
 31 KOG2828 Acetyl-CoA hydrolase [  29.9      22 0.00048   35.2   0.7   19  132-150   400-418 (454)
 32 PF11335 DUF3137:  Protein of u  28.7      24 0.00052   28.8   0.6   50  132-197    62-111 (142)
 33 COG1631 RPL42A Ribosomal prote  27.6      26 0.00057   28.0   0.6   13  182-194     6-18  (94)
 34 COG4098 comFA Superfamily II D  27.1      25 0.00055   34.6   0.6   13  169-191    55-67  (441)
 35 PF03966 Trm112p:  Trm112p-like  24.9      36 0.00077   24.7   0.9   13  183-195    52-64  (68)
 36 smart00531 TFIIE Transcription  24.0      40 0.00087   28.0   1.1   42  151-196    94-135 (147)
 37 PF01485 IBR:  IBR domain;  Int  24.0   1E+02  0.0022   20.9   3.0   42  155-196    17-60  (64)
 38 COG3809 Uncharacterized protei  23.7      34 0.00074   26.8   0.6   12  184-195    21-32  (88)
 39 KOG1773 Stress responsive prot  23.7      22 0.00047   26.5  -0.4   15  129-143    45-59  (63)
 40 PRK14810 formamidopyrimidine-D  23.4      49  0.0011   30.3   1.7   26  158-191   246-271 (272)
 41 COG1579 Zn-ribbon protein, pos  23.4      23 0.00051   32.5  -0.4   33  162-194   198-231 (239)
 42 PF02150 RNA_POL_M_15KD:  RNA p  23.2      27 0.00058   22.7  -0.0   14  185-198     2-15  (35)
 43 PF00471 Ribosomal_L33:  Riboso  22.7      59  0.0013   22.6   1.6   17  177-193    25-41  (48)
 44 PF10588 NADH-G_4Fe-4S_3:  NADH  22.5 1.5E+02  0.0032   19.7   3.5   40   97-137     2-41  (41)
 45 PRK14890 putative Zn-ribbon RN  22.1      59  0.0013   24.0   1.5   16  178-193    19-34  (59)
 46 smart00661 RPOL9 RNA polymeras  21.7      43 0.00093   22.4   0.7   12  186-197     2-13  (52)
 47 PF08121 Toxin_33:  Waglerin fa  21.6      55  0.0012   19.3   1.1   15  222-236     4-18  (22)

No 1  
>KOG3092 consensus Casein kinase II, beta subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription]
Probab=100.00  E-value=1.1e-95  Score=633.07  Aligned_cols=192  Identities=70%  Similarity=1.289  Sum_probs=184.6

Q ss_pred             CCCCCChHHHHhCCCCCeeEEecCcccccCCCccCCCCCCCCCHHHHHHHHcCCCCCCCCCCChhhHHHHHHHHHHHhcc
Q 026009           53 DGDDTSWISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVESSHGDMFTEEQNELVESAAEMLYGL  132 (245)
Q Consensus        53 ~~~~~sWI~wFcsl~gneff~eVdedyI~D~FNL~GL~~~V~~y~~aL~~ILd~~~~~~~~~~~~~~~~ie~~A~~LYGL  132 (245)
                      ++++.+||+|||+++|||||||||+|||+|+|||+||+.+||+|++||++|||.+++++....+++.+++|++|++||||
T Consensus         3 ~see~sWI~wFc~~~GnEffceVdeeyIqD~FNltgL~~~Vp~y~~ald~ILD~~~~~~~e~~~~~~~~iE~aae~LYGL   82 (216)
T KOG3092|consen    3 SSEEVSWISWFCGLRGNEFFCEVDEEYIQDRFNLTGLSEQVPNYRQALDLILDLEPDDELEDNAEQSELIESAAEMLYGL   82 (216)
T ss_pred             cccccchHHHHhcCCCCeeeEecCHHHhhhhhccccccccCchHHHHHHHhhcCCCCcccccchhHHHHHHHHHHHHHHh
Confidence            34455799999999999999999999999999999999999999999999999998887766666778999999999999


Q ss_pred             ccceeeeChHHHHHHHHhhhcCccccCCCccCCCCCccccccCCCCCCccceeecCCCCccccCCCCCCCcccccccCCc
Q 026009          133 IHVRYILTSKGMAAMLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTT  212 (245)
Q Consensus       133 IHARYIlT~~Gl~~M~eKY~~g~FG~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P~s~~~~~iDGAyFGts  212 (245)
                      ||||||+|.+||++|++||++++||+||||+|++|+|||+|+||+||+++||+|||+|+|||.|+|+++++|||||||||
T Consensus        83 IHaRYIlT~~Gl~~M~eKy~~~dFG~CPRV~C~~q~~LPvGLsDipg~~~VklYCP~C~dvY~P~ssr~~~iDGa~fGts  162 (216)
T KOG3092|consen   83 IHARYILTNRGLAAMLEKYKNGDFGRCPRVYCCGQPVLPVGLSDIPGKSTVKLYCPSCEDVYIPKSSRHGNIDGAYFGTS  162 (216)
T ss_pred             hhheeeechHHHHHHHHHHhcCCCCcCCcccccCCccccccccCCCCcceEEEeCCCcccccccccccccccccchhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHhCCCCCCCCCCCcceeeeeeeecC
Q 026009          213 FPHLFLMTYGHLKPQKATQSYVPRVFGFKLHK  244 (245)
Q Consensus       213 Fphlfl~~yP~l~p~~~~~~Y~PrIfGFkI~~  244 (245)
                      |||||||+||++.|+++.++|+|||||||||+
T Consensus       163 FPhmff~~~p~l~P~r~~~~yvPriyGFkih~  194 (216)
T KOG3092|consen  163 FPHMFFMTHPELRPKRPTEQYVPRIYGFKIHK  194 (216)
T ss_pred             CchhHHHhccccCCCcchhhhcchheeeeeCc
Confidence            99999999999999999999999999999997


No 2  
>PTZ00396 Casein kinase II subunit beta; Provisional
Probab=100.00  E-value=2.5e-91  Score=628.00  Aligned_cols=204  Identities=52%  Similarity=1.005  Sum_probs=187.3

Q ss_pred             ccccccCCCCC-CCCCCChHHHHhCCCCCeeEEecCcccccCCCccCCCCCCCCCHHHHHHHHcCCCCCCCCCCChhhHH
Q 026009           42 TDSEESDVSGS-DGDDTSWISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVESSHGDMFTEEQNE  120 (245)
Q Consensus        42 ~~~~~s~~s~~-~~~~~sWI~wFcsl~gneff~eVdedyI~D~FNL~GL~~~V~~y~~aL~~ILd~~~~~~~~~~~~~~~  120 (245)
                      .++++++++++ ++++.+||+|||+++||+|||+||+|||+|+|||+||+.+|++|++||+||||.++++++...++..+
T Consensus         5 ~~~~~~~~~~~~s~~~~sWI~wF~~~~gne~f~~Vd~dyI~D~FNl~GL~~~v~~y~~al~~Ild~~~~~~~~~~~~~~~   84 (251)
T PTZ00396          5 FSDEESSYSEEPSEESMGWIEWFCSLKGHEFLCEVDEDFIRDEFNLYGLKSKFPFYNEALDMILDSEPPDDEDLEDEQFL   84 (251)
T ss_pred             cccccccccccCCCCcCcHHHHHhCCCCCeeEEEeCHHHhcCcchhhCccccccCHHHHHHHHcCCCCCccccccchhHH
Confidence            33444444433 35677999999999999999999999999999999999999999999999999987765544556778


Q ss_pred             HHHHHHHHHhccccceeeeChHHHHHHHHhhhcCccccCCCccCCCCCccccccCCCCCCccceeecCCCCccccCCCCC
Q 026009          121 LVESAAEMLYGLIHVRYILTSKGMAAMLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKY  200 (245)
Q Consensus       121 ~ie~~A~~LYGLIHARYIlT~~Gl~~M~eKY~~g~FG~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P~s~~  200 (245)
                      .++++|++||||||||||+|++||++|++||++|+||+||||+|++|+|||||+||+||+++||+|||+|+|||+|++.+
T Consensus        85 ~i~~~a~~LYGLIHARyI~T~~Gl~~M~eKY~~g~FG~CPRv~C~~q~~LPvGlSd~~g~~~VKlyCP~C~DvY~p~s~~  164 (251)
T PTZ00396         85 EVYQEASDLYGLIHARFITTPKGLALMREKYLQGKFGHCPRVLCEGQNVLPIGLSDVLKTSRVKVYCPRCQEVYHPKKSS  164 (251)
T ss_pred             HHHHHHHHHHHHHhHhHhcCHHHHHHHHHHhhCCCCCCCCCccCCCCcccccccCCCcCcCceeEeCCCchhhcCCCCcc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999877


Q ss_pred             CCcccccccCCchhhHHHHHhCCCCCCCCCCCcceeeeeeeecCC
Q 026009          201 QGNIDGAYFGTTFPHLFLMTYGHLKPQKATQSYVPRVFGFKLHKP  245 (245)
Q Consensus       201 ~~~iDGAyFGtsFphlfl~~yP~l~p~~~~~~Y~PrIfGFkI~~~  245 (245)
                      +..||||||||||||||+|+||++.|+++.++|+|||||||||++
T Consensus       165 ~~~iDGA~FGtsFph~fl~~~p~l~p~~~~~~yvPrifGFki~~~  209 (251)
T PTZ00396        165 LLDIDGAFFGTSFPHLFLMTYPELIPTKPPQYYVPKIFGFKVHKK  209 (251)
T ss_pred             ccccccceecCcHHHHHHHhccccCCCCCCCccCCeeeeEEeccc
Confidence            669999999999999999999999999999999999999999964


No 3  
>PF01214 CK_II_beta:  Casein kinase II regulatory subunit;  InterPro: IPR000704 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Casein kinase, a ubiquitous, well-conserved protein kinase involved in cell metabolism and differentiation, is characterised by its preference for Ser or Thr in acidic stretches of amino acids. The enzyme is a tetramer of 2 alpha- and 2 beta-subunits [, ]. However, some species (e.g., mammals) possess 2 related forms of the alpha-subunit (alpha and alpha'), while others (e.g., fungi) possess 2 related beta-subunits (beta and beta') []. The alpha-subunit is the catalytic unit and contains regions characteristic of serine/threonine protein kinases. The beta-subunit is believed to be regulatory, possessing an N-terminal auto-phosphorylation site, an internal acidic domain, and a potential metal-binding motif []. The beta subunit is a highly conserved protein of about 25kDa that contains, in its central section, a cysteine-rich motif, CX(n)C, that could be involved in binding a metal such as zinc []. The mammalian beta-subunit gene promoter shares common features with those of other mammalian protein kinases and is closely related to the promoter of the regulatory subunit of cAMP-dependent protein kinase [].; GO: 0019887 protein kinase regulator activity, 0005956 protein kinase CK2 complex; PDB: 2R6M_B 1RQF_K 1DS5_G 1QF8_B 3EED_A 4DGL_A 1JWH_D.
Probab=100.00  E-value=1e-88  Score=587.81  Aligned_cols=184  Identities=64%  Similarity=1.221  Sum_probs=153.6

Q ss_pred             ChHHHHhCCCCCeeEEecCcccccCCCccCCCCCCCCCHHHHHHHHcCCCCCCCCCCChhhHHHHHHHHHHHhcccccee
Q 026009           58 SWISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVESSHGDMFTEEQNELVESAAEMLYGLIHVRY  137 (245)
Q Consensus        58 sWI~wFcsl~gneff~eVdedyI~D~FNL~GL~~~V~~y~~aL~~ILd~~~~~~~~~~~~~~~~ie~~A~~LYGLIHARY  137 (245)
                      +||+|||+++||+||||||+|||+|+|||+||+++||+|++||++|||.+.++++..++++.+.++++|++|||||||||
T Consensus         1 sWI~~F~~~~~~~~f~~Vd~dyI~D~FNl~GL~~~v~~y~~al~~Ild~~~~~~~~~~~~~~~~i~~~a~~LYGLIHaRy   80 (184)
T PF01214_consen    1 SWIDWFCSLKGNEFFCEVDEDYIEDSFNLYGLSSQVPNYDEALDMILDKEPDEDEESDDESDDEIEKSAEMLYGLIHARY   80 (184)
T ss_dssp             -HHHHHHHSTTTTT-----HHHHHSGGGGTTGGGTSTTHHHHHHHHTT----TTTTTTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHhCCCCCeEEEEeCHHHHhCcchhcChhhccccHHHHHHHHcCCCcccchhccchhHHHHHHHHHHHHhhhHHHH
Confidence            69999999999999999999999999999999999999999999999998876555666778889999999999999999


Q ss_pred             eeChHHHHHHHHhhhcCccccCCCccCCCCCccccccCCCCCCccceeecCCCCccccCCCCCCCcccccccCCchhhHH
Q 026009          138 ILTSKGMAAMLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLF  217 (245)
Q Consensus       138 IlT~~Gl~~M~eKY~~g~FG~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P~s~~~~~iDGAyFGtsFphlf  217 (245)
                      |+|++||++|++||++|+||+||||+|++|+|||+|+||+||+++||||||+|+|||+|++.++++||||||||||||||
T Consensus        81 I~T~~Gl~~m~eKy~~g~FG~CPRv~C~~~~lLPiGlsd~~g~~~vKlyCP~C~dvY~p~~~~~~~iDGA~FG~sFph~f  160 (184)
T PF01214_consen   81 ILTPRGLEQMKEKYEQGDFGRCPRVYCNGQPLLPIGLSDTPGESTVKLYCPRCKDVYHPPSSRHSNIDGAYFGPSFPHLF  160 (184)
T ss_dssp             TTSHHHHHHHHHHHHTTTT-B-SBGGGTT-B-EEEBS-SSTTS-BBEEEETTTTEEE--SSGGGTTSBGGGTTSSHHHHH
T ss_pred             hhcHHHHHHHHHhhcCCcCCcCCcccCCCCceeCccCCCCCCccceeEECCCCccccCCCCccccceeccccCCccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999888888999999999999999


Q ss_pred             HHHhCCCCCCCCCCCcceeeeeee
Q 026009          218 LMTYGHLKPQKATQSYVPRVFGFK  241 (245)
Q Consensus       218 l~~yP~l~p~~~~~~Y~PrIfGFk  241 (245)
                      +|+||++.|+.+.++|+|||||||
T Consensus       161 ~~~~p~~~~~~~~~~y~PrifGFk  184 (184)
T PF01214_consen  161 LMTYPELIPSPPPKPYVPRIFGFK  184 (184)
T ss_dssp             HHH-GGGS-SS-SS----ECTTCE
T ss_pred             HHHCccccCCCCCCccCCcccccC
Confidence            999999999999999999999998


No 4  
>COG5041 SKB2 Casein kinase II, beta subunit [Signal transduction mechanisms / Cell division and chromosome partitioning / Transcription]
Probab=100.00  E-value=9.8e-86  Score=575.44  Aligned_cols=188  Identities=54%  Similarity=1.131  Sum_probs=178.3

Q ss_pred             CCCChHHHHhCCCCCeeEEecCcccccCCCccCCCCCCCCCHHHHHHHHcCCCCCCCCCCChhhHHHHHHHHHHHhcccc
Q 026009           55 DDTSWISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVESSHGDMFTEEQNELVESAAEMLYGLIH  134 (245)
Q Consensus        55 ~~~sWI~wFcsl~gneff~eVdedyI~D~FNL~GL~~~V~~y~~aL~~ILd~~~~~~~~~~~~~~~~ie~~A~~LYGLIH  134 (245)
                      +...||+|||+++||||||+||++||+|.|||+||+..||+|++||++|||...++.  ..+.+.+.||.+|++||||||
T Consensus        22 ~y~~Wi~~F~~rkg~eyfc~V~~efIeDrFNltgL~~~Vp~y~~~ldlILD~~~~~~--~e~~~~d~iE~sa~~LYgLIH   99 (242)
T COG5041          22 EYDEWIDWFCSRKGNEYFCEVPEEFIEDRFNLTGLSREVPHYSEVLDLILDKLAPSN--LENDEVDIIEESARQLYGLIH   99 (242)
T ss_pred             HHHHHHHHHHcCCCCeeeeeCCHHHHHhhhhccchhhccchHHHHHHHHHhccCCcc--hhhhhhHHHHHHHHHHHHHHH
Confidence            344799999999999999999999999999999999999999999999999876543  233446789999999999999


Q ss_pred             ceeeeChHHHHHHHHhhhcCccccCCCccCCCCCccccccCCCCCCccceeecCCCCccccCCCCCCCcccccccCCchh
Q 026009          135 VRYILTSKGMAAMLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFP  214 (245)
Q Consensus       135 ARYIlT~~Gl~~M~eKY~~g~FG~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P~s~~~~~iDGAyFGtsFp  214 (245)
                      ||||+|..||++|.+||+.++||+||||+||+|+|||+||||+||+++||||||+|.|||.|+|+++..|||||||||||
T Consensus       100 aRyIiT~~GL~~m~eKy~~~efG~CPRv~Cn~~~vLPvGLsDi~g~~~vkLyCpsC~dlY~p~Ssr~~~iDGa~fGtSFP  179 (242)
T COG5041         100 ARYIITKSGLQAMLEKYKSREFGACPRVYCNGQQVLPVGLSDIPGKSSVKLYCPSCEDLYLPKSSRHQSIDGAFFGTSFP  179 (242)
T ss_pred             hhheeeHHHHHHHHHHHhhcccCCCCcccccCcceeccccccCCCCceeEEecCchhhhcCcccccccccccchhccCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHhCCCCCCCCCCCcceeeeeeeecC
Q 026009          215 HLFLMTYGHLKPQKATQSYVPRVFGFKLHK  244 (245)
Q Consensus       215 hlfl~~yP~l~p~~~~~~Y~PrIfGFkI~~  244 (245)
                      |||+++||++.|+++.+.|+|||||||||+
T Consensus       180 h~f~~~~pel~p~~~~e~YiprIfGfri~~  209 (242)
T COG5041         180 HMFLQTFPELFPKRSCERYIPRIFGFRIHS  209 (242)
T ss_pred             hHHHHhchhhcCCcchhhhcceeeeeEeeh
Confidence            999999999999999999999999999986


No 5  
>PRK05978 hypothetical protein; Provisional
Probab=82.31  E-value=1.4  Score=37.68  Aligned_cols=42  Identities=17%  Similarity=0.219  Sum_probs=32.8

Q ss_pred             HHHhhhcCccccCCCccCCCCCccccccCCCCCCccceeecCCCCccccCC
Q 026009          147 MLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPR  197 (245)
Q Consensus       147 M~eKY~~g~FG~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P~  197 (245)
                      +..-..+|-.|+|||  |..-+++=       +--+|+--||.|..-|.+.
T Consensus        24 ~~~~~~rGl~grCP~--CG~G~LF~-------g~Lkv~~~C~~CG~~~~~~   65 (148)
T PRK05978         24 VGRAMWRGFRGRCPA--CGEGKLFR-------AFLKPVDHCAACGEDFTHH   65 (148)
T ss_pred             hHHHHHHHHcCcCCC--CCCCcccc-------cccccCCCccccCCccccC
Confidence            445678899999998  77777762       5567888999999999753


No 6  
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=75.12  E-value=2.9  Score=34.83  Aligned_cols=41  Identities=34%  Similarity=0.835  Sum_probs=27.6

Q ss_pred             cCccccCCCccCCCCCccccccCCCCC--------CccceeecCCCCccccC
Q 026009          153 NYDFGRCPRVYCCGQPCLPVGQSDIPR--------SSTVKIYCPKCEDIYYP  196 (245)
Q Consensus       153 ~g~FG~CPRv~C~~q~lLPiGlSd~pg--------~s~VKlyCP~C~DvY~P  196 (245)
                      +..|.+||+  ||+ ++.|+...+..+        ....=..||.|+.||=+
T Consensus        88 ~~~~sRC~~--CN~-~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~  136 (147)
T PF01927_consen   88 DPIFSRCPK--CNG-PLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWE  136 (147)
T ss_pred             CCCCCccCC--CCc-EeeechhhccccccCccccccCCeEEECCCCCCEecc
Confidence            445899986  666 788886554322        22235679999999954


No 7  
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=71.28  E-value=4.2  Score=35.48  Aligned_cols=62  Identities=27%  Similarity=0.491  Sum_probs=42.5

Q ss_pred             ccceeeeChHHHHHHHHh---hh-----cCccccCCCccCCCCCccccccCC--------CCCCccceeecCCCCccccC
Q 026009          133 IHVRYILTSKGMAAMLEK---YK-----NYDFGRCPRVYCCGQPCLPVGQSD--------IPRSSTVKIYCPKCEDIYYP  196 (245)
Q Consensus       133 IHARYIlT~~Gl~~M~eK---Y~-----~g~FG~CPRv~C~~q~lLPiGlSd--------~pg~s~VKlyCP~C~DvY~P  196 (245)
                      +++=||-+..=.+||.+=   +.     +-+|-+||.  ||+ +++++-...        +.+....-..||+|..+|=+
T Consensus        66 ~~~i~i~~~s~~~Ql~e~~~~~~l~~~~~~e~~RCp~--CN~-~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW~  142 (165)
T COG1656          66 IKAILIRSDSIEEQLAEFLARLGLKPRLFPEFSRCPE--CNG-ELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYWK  142 (165)
T ss_pred             CceEEEeCCCHHHHHHHHHHHhccchhcccccccCcc--cCC-EeccCcHHHHhhccchhhhhcccceeECCCCcccccC
Confidence            677788888877787765   21     344889994  777 688776655        22333444559999999975


Q ss_pred             C
Q 026009          197 R  197 (245)
Q Consensus       197 ~  197 (245)
                      -
T Consensus       143 G  143 (165)
T COG1656         143 G  143 (165)
T ss_pred             c
Confidence            3


No 8  
>KOG4684 consensus Uncharacterized conserved protein, contains C4-type Zn-finger [General function prediction only]
Probab=50.66  E-value=14  Score=33.96  Aligned_cols=36  Identities=19%  Similarity=0.578  Sum_probs=25.5

Q ss_pred             CCCccCCCC----CccccccCCCCCCccceeecCCCCccc
Q 026009          159 CPRVYCCGQ----PCLPVGQSDIPRSSTVKIYCPKCEDIY  194 (245)
Q Consensus       159 CPRv~C~~q----~lLPiGlSd~pg~s~VKlyCP~C~DvY  194 (245)
                      |||-+|++-    ++.|--++..+.-..+++-|-.|++.|
T Consensus       141 CPRpnCkRiInL~p~~~~p~~P~~~P~gcRV~CgHC~~tF  180 (275)
T KOG4684|consen  141 CPRPNCKRIINLDPLIEKPRDPGTAPTGCRVKCGHCNETF  180 (275)
T ss_pred             cCCCCcceeeecCCCCCCCCCCCCCCcceEEEecCcccee
Confidence            999999863    333434444444456899999999988


No 9  
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=50.34  E-value=25  Score=24.05  Aligned_cols=23  Identities=30%  Similarity=0.588  Sum_probs=14.8

Q ss_pred             HHHhhhc--CccccCCCccCCCCCc
Q 026009          147 MLEKYKN--YDFGRCPRVYCCGQPC  169 (245)
Q Consensus       147 M~eKY~~--g~FG~CPRv~C~~q~l  169 (245)
                      +.++|.+  ..+-.||+..|+..-.
T Consensus         7 ~~~~~i~~~~~~~~CP~~~C~~~~~   31 (64)
T smart00647        7 LLESYVESNPDLKWCPAPDCSAAII   31 (64)
T ss_pred             HHHHHHhcCCCccCCCCCCCcceEE
Confidence            3444433  4677899999976433


No 10 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=48.87  E-value=7.5  Score=28.25  Aligned_cols=11  Identities=45%  Similarity=1.407  Sum_probs=8.7

Q ss_pred             cceeecCCCCc
Q 026009          182 TVKIYCPKCED  192 (245)
Q Consensus       182 ~VKlyCP~C~D  192 (245)
                      ..-||||+|+.
T Consensus        26 NfPlyCpKCK~   36 (55)
T PF14205_consen   26 NFPLYCPKCKQ   36 (55)
T ss_pred             cccccCCCCCc
Confidence            34799999964


No 11 
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=46.82  E-value=4.3  Score=37.60  Aligned_cols=58  Identities=34%  Similarity=0.749  Sum_probs=25.9

Q ss_pred             ccCCCccCCCCCccccccCCCCCCccc-eeecCCCCccccCCCCCC---C-cccccccC-------CchhhHHHHHh
Q 026009          157 GRCPRVYCCGQPCLPVGQSDIPRSSTV-KIYCPKCEDIYYPRSKYQ---G-NIDGAYFG-------TTFPHLFLMTY  221 (245)
Q Consensus       157 G~CPRv~C~~q~lLPiGlSd~pg~s~V-KlyCP~C~DvY~P~s~~~---~-~iDGAyFG-------tsFphlfl~~y  221 (245)
                      +.||+  |+..++-=+     +.-.+| -.|||+|++-|.-+|...   . -.||||--       .+=|.+|+|+|
T Consensus        32 ~yCP~--Cg~~~L~~f-----~NN~PVaDF~C~~C~eeyELKSk~~~l~~~I~dGAY~Tmi~Ri~s~~NPnfffl~Y  101 (254)
T PF06044_consen   32 MYCPN--CGSKPLSKF-----ENNRPVADFYCPNCNEEYELKSKKKKLSNKINDGAYHTMIERITSDNNPNFFFLTY  101 (254)
T ss_dssp             ---TT--T--SS-EE-------------EEE-TTT--EEEEEEEESS--SEEEEEEHHHHHHHHHTT---EEEEEEE
T ss_pred             CcCCC--CCChhHhhc-----cCCCccceeECCCCchHHhhhhhccccCCcccCccHHHHHHHhhccCCCCEEEEEe
Confidence            46886  444333322     344555 578999999999875331   1 34999963       24577788887


No 12 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=45.86  E-value=17  Score=24.68  Aligned_cols=23  Identities=48%  Similarity=1.292  Sum_probs=15.4

Q ss_pred             cCCCccCCCCCccccccCCCCCCccceeecCCCC
Q 026009          158 RCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCE  191 (245)
Q Consensus       158 ~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~  191 (245)
                      +||.  | +.|++.    +  +.+  ++|||.|.
T Consensus        19 ~Cp~--C-~~PL~~----~--k~g--~~~Cv~C~   41 (41)
T PF06677_consen   19 HCPD--C-GTPLMR----D--KDG--KIYCVSCG   41 (41)
T ss_pred             ccCC--C-CCeeEE----e--cCC--CEECCCCC
Confidence            6994  7 677775    1  122  68999994


No 13 
>PRK00420 hypothetical protein; Validated
Probab=45.22  E-value=24  Score=28.88  Aligned_cols=30  Identities=23%  Similarity=0.643  Sum_probs=20.8

Q ss_pred             ccCCCccCCCCCccccccCCCCCCccceeecCCCCccccCC
Q 026009          157 GRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPR  197 (245)
Q Consensus       157 G~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P~  197 (245)
                      ++||.  |. .|++        +...-+.|||.|..++.-.
T Consensus        24 ~~CP~--Cg-~pLf--------~lk~g~~~Cp~Cg~~~~v~   53 (112)
T PRK00420         24 KHCPV--CG-LPLF--------ELKDGEVVCPVHGKVYIVK   53 (112)
T ss_pred             CCCCC--CC-Ccce--------ecCCCceECCCCCCeeeec
Confidence            79998  65 3433        2233489999999999754


No 14 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=44.53  E-value=14  Score=24.18  Aligned_cols=13  Identities=46%  Similarity=1.007  Sum_probs=10.9

Q ss_pred             eeecCCCCccccC
Q 026009          184 KIYCPKCEDIYYP  196 (245)
Q Consensus       184 KlyCP~C~DvY~P  196 (245)
                      +..||.|..+||.
T Consensus         1 Rr~C~~Cg~~Yh~   13 (36)
T PF05191_consen    1 RRICPKCGRIYHI   13 (36)
T ss_dssp             EEEETTTTEEEET
T ss_pred             CcCcCCCCCcccc
Confidence            3579999999985


No 15 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=43.75  E-value=10  Score=23.26  Aligned_cols=10  Identities=30%  Similarity=1.265  Sum_probs=7.1

Q ss_pred             eeecCCCCcc
Q 026009          184 KIYCPKCEDI  193 (245)
Q Consensus       184 KlyCP~C~Dv  193 (245)
                      --|||+|.+|
T Consensus        21 ~~~C~rCq~v   30 (30)
T PF06827_consen   21 TYLCPRCQKV   30 (30)
T ss_dssp             EEE-TTTCCH
T ss_pred             CeECcCCcCC
Confidence            4689999875


No 16 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=43.18  E-value=12  Score=24.01  Aligned_cols=28  Identities=21%  Similarity=0.387  Sum_probs=16.6

Q ss_pred             CCCCCccccccCCCCCCccceeecCCCCccc
Q 026009          164 CCGQPCLPVGQSDIPRSSTVKIYCPKCEDIY  194 (245)
Q Consensus       164 C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY  194 (245)
                      |..+.-+|-..-   +....++-||+|+...
T Consensus         8 C~~~~~v~~~~~---~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         8 CKTSFRVVDSQL---GANGGKVRCGKCGHVW   35 (38)
T ss_pred             CCCEEEeCHHHc---CCCCCEEECCCCCCEE
Confidence            555555554332   2334478888887765


No 17 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=39.86  E-value=19  Score=26.73  Aligned_cols=17  Identities=35%  Similarity=0.960  Sum_probs=14.5

Q ss_pred             CCCCccceeecCCCCcc
Q 026009          177 IPRSSTVKIYCPKCEDI  193 (245)
Q Consensus       177 ~pg~s~VKlyCP~C~Dv  193 (245)
                      .|++..|+-.||+|.++
T Consensus        20 ~p~e~~v~F~CPnCGe~   36 (61)
T COG2888          20 APGETAVKFPCPNCGEV   36 (61)
T ss_pred             ccCCceeEeeCCCCCce
Confidence            37889999999999954


No 18 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=39.76  E-value=14  Score=25.94  Aligned_cols=10  Identities=30%  Similarity=1.168  Sum_probs=5.1

Q ss_pred             ceeecCCCCc
Q 026009          183 VKIYCPKCED  192 (245)
Q Consensus       183 VKlyCP~C~D  192 (245)
                      ++-|||+|..
T Consensus        19 ~~~fCP~Cg~   28 (50)
T PRK00432         19 KNKFCPRCGS   28 (50)
T ss_pred             ccCcCcCCCc
Confidence            3445555554


No 19 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=39.57  E-value=11  Score=28.60  Aligned_cols=13  Identities=38%  Similarity=1.042  Sum_probs=5.6

Q ss_pred             ccceeecCCCCcc
Q 026009          181 STVKIYCPKCEDI  193 (245)
Q Consensus       181 s~VKlyCP~C~Dv  193 (245)
                      .+-|.|||+|.--
T Consensus        21 ~~~k~FCp~CGn~   33 (73)
T PF08772_consen   21 DMTKQFCPKCGNA   33 (73)
T ss_dssp             -SS--S-SSS--S
T ss_pred             CCCceeCcccCCC
Confidence            4569999999753


No 20 
>COG0401 Uncharacterized homolog of Blt101 [Function unknown]
Probab=37.92  E-value=9.7  Score=27.74  Aligned_cols=13  Identities=31%  Similarity=0.749  Sum_probs=11.0

Q ss_pred             HhccccceeeeCh
Q 026009          129 LYGLIHVRYILTS  141 (245)
Q Consensus       129 LYGLIHARYIlT~  141 (245)
                      +=|+|||-|+++.
T Consensus        43 ~PGiiHA~yvi~~   55 (56)
T COG0401          43 IPGIIHALYVILR   55 (56)
T ss_pred             hhhhHhheEEEEe
Confidence            5589999999875


No 21 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=36.37  E-value=20  Score=23.62  Aligned_cols=12  Identities=25%  Similarity=1.143  Sum_probs=10.2

Q ss_pred             ccceeecCCCCc
Q 026009          181 STVKIYCPKCED  192 (245)
Q Consensus       181 s~VKlyCP~C~D  192 (245)
                      ++|.+.||+|+.
T Consensus         2 a~i~v~CP~C~s   13 (36)
T PF03811_consen    2 AKIDVHCPRCQS   13 (36)
T ss_pred             CcEeeeCCCCCC
Confidence            578999999974


No 22 
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=35.29  E-value=9.2  Score=28.06  Aligned_cols=28  Identities=29%  Similarity=0.636  Sum_probs=18.0

Q ss_pred             CccCCCCCccccccCCCCCCccceeecCCCCcccc
Q 026009          161 RVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYY  195 (245)
Q Consensus       161 Rv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~  195 (245)
                      +.+|..  +.|.+.+..+  ..|   ||.|++||.
T Consensus        28 vALCGk--~wvp~rdp~~--~PV---CP~Ck~iye   55 (58)
T PF11238_consen   28 VALCGK--VWVPTRDPKP--FPV---CPECKEIYE   55 (58)
T ss_pred             EeeeCc--eeCCCCCCCC--CCC---CcCHHHHHH
Confidence            566664  4555554333  444   999999995


No 23 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=34.55  E-value=24  Score=22.98  Aligned_cols=15  Identities=33%  Similarity=0.766  Sum_probs=12.4

Q ss_pred             ceeecCCCCccccCC
Q 026009          183 VKIYCPKCEDIYYPR  197 (245)
Q Consensus       183 VKlyCP~C~DvY~P~  197 (245)
                      +++-||+|+-.|.-+
T Consensus         1 M~i~Cp~C~~~y~i~   15 (36)
T PF13717_consen    1 MIITCPNCQAKYEID   15 (36)
T ss_pred             CEEECCCCCCEEeCC
Confidence            578899999999754


No 24 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=34.08  E-value=19  Score=26.32  Aligned_cols=17  Identities=18%  Similarity=0.698  Sum_probs=13.3

Q ss_pred             CCCccceeecCCCCccc
Q 026009          178 PRSSTVKIYCPKCEDIY  194 (245)
Q Consensus       178 pg~s~VKlyCP~C~DvY  194 (245)
                      -+++-++.-||||+.|=
T Consensus        18 ~~~~yle~KCPrCK~vN   34 (60)
T COG4416          18 EGQAYLEKKCPRCKEVN   34 (60)
T ss_pred             ccceeeeecCCccceee
Confidence            34667889999998874


No 25 
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=34.04  E-value=25  Score=25.70  Aligned_cols=19  Identities=37%  Similarity=0.856  Sum_probs=15.5

Q ss_pred             CCccceeecCCCCccccCC
Q 026009          179 RSSTVKIYCPKCEDIYYPR  197 (245)
Q Consensus       179 g~s~VKlyCP~C~DvY~P~  197 (245)
                      +..++.++||+|+..=.+.
T Consensus         2 ~~~p~~~~CP~C~~~~~T~   20 (73)
T PF10601_consen    2 GPEPVRIYCPYCQQQVQTR   20 (73)
T ss_pred             CCCceeeECCCCCCEEEEE
Confidence            5678999999999887653


No 26 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=33.74  E-value=20  Score=23.30  Aligned_cols=29  Identities=24%  Similarity=0.547  Sum_probs=19.0

Q ss_pred             CCCCCccccccCCCCCCccceeecCCCCcccc
Q 026009          164 CCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYY  195 (245)
Q Consensus       164 C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~  195 (245)
                      |+...-||-.   ..+.+..++-||+|+.++.
T Consensus         8 C~~~f~v~~~---~l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    8 CQTRFRVPDD---KLPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             CCceEEcCHH---HcccCCcEEECCCCCcEee
Confidence            5555444432   2446677999999998873


No 27 
>KOG0435 consensus Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=33.44  E-value=26  Score=37.18  Aligned_cols=57  Identities=25%  Similarity=0.638  Sum_probs=38.3

Q ss_pred             cCcccc-CCCccCCCCCccccccCCCCCCcc------------------ceeecCCCCccccCCCCCCCcccccccCCch
Q 026009          153 NYDFGR-CPRVYCCGQPCLPVGQSDIPRSST------------------VKIYCPKCEDIYYPRSKYQGNIDGAYFGTTF  213 (245)
Q Consensus       153 ~g~FG~-CPRv~C~~q~lLPiGlSd~pg~s~------------------VKlyCP~C~DvY~P~s~~~~~iDGAyFGtsF  213 (245)
                      +.-+|+ =|-|.|..+--+||-+|+-|=.-+                  |+.-||+|++   |....-...| .|+++++
T Consensus       427 QRyWGTPIPivhc~~cG~vpVpes~LPV~LP~l~~~~~kG~Pls~~~e~vn~~cP~cg~---pAkRETDTMD-TFvDSsW  502 (876)
T KOG0435|consen  427 QRYWGTPIPIVHCDDCGAVPVPESELPVTLPELNDFTPKGPPLSKADEWVNVDCPRCGE---PAKRETDTMD-TFVDSSW  502 (876)
T ss_pred             hhccCCCcceEEcCCCCcccCcHHHCCcccccccccCCCCCcccchhhheeccCccCCC---cccccccccc-hhhccce
Confidence            444564 689999999988888887765444                  8899999998   4322221333 5555554


No 28 
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=32.89  E-value=38  Score=31.56  Aligned_cols=37  Identities=24%  Similarity=0.660  Sum_probs=23.7

Q ss_pred             CCCccCCCCCcc-cc--cc-CCCC--CCccceeecCCCCcccc
Q 026009          159 CPRVYCCGQPCL-PV--GQ-SDIP--RSSTVKIYCPKCEDIYY  195 (245)
Q Consensus       159 CPRv~C~~q~lL-Pi--Gl-Sd~p--g~s~VKlyCP~C~DvY~  195 (245)
                      |||-+|++--.| |.  |- +..+  .-.++++-|++|++.+.
T Consensus       126 CPRp~CkRiI~L~~~~~~p~~~~~~~~p~~~rv~CghC~~~Fl  168 (256)
T PF09788_consen  126 CPRPNCKRIINLGPSHQGPVTPPVPTQPGSCRVICGHCSNTFL  168 (256)
T ss_pred             CCCCCCcceEEeCCccCCCCCCCCCCCCCceeEECCCCCCcEe
Confidence            999999974333 22  01 1111  22578999999999985


No 29 
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics]
Probab=32.15  E-value=28  Score=32.59  Aligned_cols=39  Identities=33%  Similarity=0.774  Sum_probs=27.3

Q ss_pred             hhhcCccccCCCccCCCCCc------cc-cccCCCCCCccceeecCCCCcc
Q 026009          150 KYKNYDFGRCPRVYCCGQPC------LP-VGQSDIPRSSTVKIYCPKCEDI  193 (245)
Q Consensus       150 KY~~g~FG~CPRv~C~~q~l------LP-iGlSd~pg~s~VKlyCP~C~Dv  193 (245)
                      ..+++-||.  =|.|.+.+|      || |||..-|+   -+.|||-|++.
T Consensus       225 fCqqvSyGq--MVaCDn~nCkrEWFH~~CVGLk~pPK---G~WYC~eCk~~  270 (271)
T COG5034         225 FCQQVSYGQ--MVACDNANCKREWFHLECVGLKEPPK---GKWYCPECKKA  270 (271)
T ss_pred             Eeccccccc--ceecCCCCCchhheeccccccCCCCC---CcEeCHHhHhc
Confidence            468899995  455555443      45 49987664   48999999874


No 30 
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics]
Probab=31.48  E-value=25  Score=32.39  Aligned_cols=38  Identities=26%  Similarity=0.518  Sum_probs=27.0

Q ss_pred             hcCccccCCCccCC-CCCccc-cccCCCCCCccceeecCCCCc
Q 026009          152 KNYDFGRCPRVYCC-GQPCLP-VGQSDIPRSSTVKIYCPKCED  192 (245)
Q Consensus       152 ~~g~FG~CPRv~C~-~q~lLP-iGlSd~pg~s~VKlyCP~C~D  192 (245)
                      .-|.++-|=...|. .--=+| |||...|..   |.|||+|+.
T Consensus       228 syg~Mi~CDn~~C~~eWFH~~CVGL~~~Pkg---kWyC~~C~~  267 (274)
T KOG1973|consen  228 SYGKMIGCDNPGCPIEWFHFTCVGLKTKPKG---KWYCPRCKA  267 (274)
T ss_pred             ccccccccCCCCCCcceEEEeccccccCCCC---cccchhhhh
Confidence            45677778888887 444455 599976654   499999964


No 31 
>KOG2828 consensus Acetyl-CoA hydrolase [Energy production and conversion]
Probab=29.87  E-value=22  Score=35.18  Aligned_cols=19  Identities=32%  Similarity=0.630  Sum_probs=15.8

Q ss_pred             cccceeeeChHHHHHHHHh
Q 026009          132 LIHVRYILTSKGMAAMLEK  150 (245)
Q Consensus       132 LIHARYIlT~~Gl~~M~eK  150 (245)
                      --|++||+|+.|+..+.-|
T Consensus       400 rah~~y~VTEhGiA~L~Gk  418 (454)
T KOG2828|consen  400 RAHLDYLVTEHGIADLWGK  418 (454)
T ss_pred             ccceeEEEecccHHHHhCC
Confidence            3599999999999987543


No 32 
>PF11335 DUF3137:  Protein of unknown function (DUF3137) ;  InterPro: IPR021484  This bacterial family of proteins has no known function. 
Probab=28.74  E-value=24  Score=28.80  Aligned_cols=50  Identities=30%  Similarity=0.468  Sum_probs=29.3

Q ss_pred             cccceeeeChHHHHHHHHhhhcCccccCCCccCCCCCccccccCCCCCCccceeecCCCCccccCC
Q 026009          132 LIHVRYILTSKGMAAMLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPR  197 (245)
Q Consensus       132 LIHARYIlT~~Gl~~M~eKY~~g~FG~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P~  197 (245)
                      .+.|||||||.=|+.+.+ +.+.. |.            |+.++  ...+++-+..+.=++.+.|+
T Consensus        62 ~~~AryiLtP~~mE~L~~-l~~~~-~~------------~i~~~--f~~~~lyiai~~~~~~Fe~~  111 (142)
T PF11335_consen   62 QVEARYILTPSFMERLLE-LRERF-GG------------PISLS--FDGNKLYIAIPSGRDLFEPS  111 (142)
T ss_pred             HHHHHHhCCHHHHHHHHH-HHHhc-CC------------CEEEE--EeCCEEEEEEeCCcccccCC
Confidence            456899999998887764 22222 32            12221  22356666666666777754


No 33 
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=27.61  E-value=26  Score=28.00  Aligned_cols=13  Identities=31%  Similarity=0.874  Sum_probs=10.5

Q ss_pred             cceeecCCCCccc
Q 026009          182 TVKIYCPKCEDIY  194 (245)
Q Consensus       182 ~VKlyCP~C~DvY  194 (245)
                      +++.|||.|+..=
T Consensus         6 ~~~tyCp~CkkhT   18 (94)
T COG1631           6 KRRTYCPYCKKHT   18 (94)
T ss_pred             ceeecCcccccce
Confidence            6789999998643


No 34 
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]
Probab=27.13  E-value=25  Score=34.62  Aligned_cols=13  Identities=46%  Similarity=1.109  Sum_probs=10.4

Q ss_pred             ccccccCCCCCCccceeecCCCC
Q 026009          169 CLPVGQSDIPRSSTVKIYCPKCE  191 (245)
Q Consensus       169 lLPiGlSd~pg~s~VKlyCP~C~  191 (245)
                      -||+|          ++||++|-
T Consensus        55 ~lp~~----------~~YCr~Cl   67 (441)
T COG4098          55 KLPCG----------CLYCRNCL   67 (441)
T ss_pred             ccccc----------eEeehhhh
Confidence            57777          89999984


No 35 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=24.89  E-value=36  Score=24.70  Aligned_cols=13  Identities=31%  Similarity=0.838  Sum_probs=11.3

Q ss_pred             ceeecCCCCcccc
Q 026009          183 VKIYCPKCEDIYY  195 (245)
Q Consensus       183 VKlyCP~C~DvY~  195 (245)
                      =.|.||.|+-+|-
T Consensus        52 g~L~Cp~c~r~YP   64 (68)
T PF03966_consen   52 GELICPECGREYP   64 (68)
T ss_dssp             TEEEETTTTEEEE
T ss_pred             CEEEcCCCCCEEe
Confidence            4899999999993


No 36 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=23.99  E-value=40  Score=28.02  Aligned_cols=42  Identities=17%  Similarity=0.391  Sum_probs=23.4

Q ss_pred             hhcCccccCCCccCCCCCccccccCCCCCCccceeecCCCCccccC
Q 026009          151 YKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYP  196 (245)
Q Consensus       151 Y~~g~FG~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~DvY~P  196 (245)
                      -.+..|=.||+  |+..--.=-.+.  ....+.+.-||.|+..-..
T Consensus        94 e~~~~~Y~Cp~--C~~~y~~~ea~~--~~d~~~~f~Cp~Cg~~l~~  135 (147)
T smart00531       94 ETNNAYYKCPN--CQSKYTFLEANQ--LLDMDGTFTCPRCGEELEE  135 (147)
T ss_pred             ccCCcEEECcC--CCCEeeHHHHHH--hcCCCCcEECCCCCCEEEE
Confidence            34566778997  664332111111  0012456899999887654


No 37 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=23.97  E-value=1e+02  Score=20.90  Aligned_cols=42  Identities=19%  Similarity=0.256  Sum_probs=16.3

Q ss_pred             ccccCCCccCCCCCccccccCCC--CCCccceeecCCCCccccC
Q 026009          155 DFGRCPRVYCCGQPCLPVGQSDI--PRSSTVKIYCPKCEDIYYP  196 (245)
Q Consensus       155 ~FG~CPRv~C~~q~lLPiGlSd~--pg~s~VKlyCP~C~DvY~P  196 (245)
                      .+-.||+..|+.--...-|....  -=..-=..||..|+.-+|+
T Consensus        17 ~~~~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~~H~   60 (64)
T PF01485_consen   17 NIRWCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGEPWHE   60 (64)
T ss_dssp             -CC--TTSST---ECS-SSTTS--CCTTSCCSEECSSSTSESCT
T ss_pred             CccCCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCcccCC
Confidence            44589999999754433333321  0000114555566555553


No 38 
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.69  E-value=34  Score=26.84  Aligned_cols=12  Identities=33%  Similarity=1.190  Sum_probs=10.0

Q ss_pred             eeecCCCCcccc
Q 026009          184 KIYCPKCEDIYY  195 (245)
Q Consensus       184 KlyCP~C~DvY~  195 (245)
                      --|||+|+-|..
T Consensus        21 iD~CPrCrGVWL   32 (88)
T COG3809          21 IDYCPRCRGVWL   32 (88)
T ss_pred             eeeCCccccEee
Confidence            359999999985


No 39 
>KOG1773 consensus Stress responsive protein [General function prediction only]
Probab=23.67  E-value=22  Score=26.50  Aligned_cols=15  Identities=40%  Similarity=0.793  Sum_probs=12.2

Q ss_pred             HhccccceeeeChHH
Q 026009          129 LYGLIHVRYILTSKG  143 (245)
Q Consensus       129 LYGLIHARYIlT~~G  143 (245)
                      +=|+|||-|+++.+|
T Consensus        45 iPgiIhA~yii~~~~   59 (63)
T KOG1773|consen   45 IPGIIHAIYIIFFRG   59 (63)
T ss_pred             hHHHHhhEEEEEEec
Confidence            458999999997654


No 40 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=23.44  E-value=49  Score=30.33  Aligned_cols=26  Identities=31%  Similarity=0.732  Sum_probs=15.6

Q ss_pred             cCCCccCCCCCccccccCCCCCCccceeecCCCC
Q 026009          158 RCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCE  191 (245)
Q Consensus       158 ~CPRv~C~~q~lLPiGlSd~pg~s~VKlyCP~C~  191 (245)
                      .|||  |.. ++.=+.+.     ++---|||.|+
T Consensus       246 pCpr--CG~-~I~~~~~~-----gR~t~~CP~CQ  271 (272)
T PRK14810        246 PCLN--CKT-PIRRVVVA-----GRSSHYCPHCQ  271 (272)
T ss_pred             cCCC--CCC-eeEEEEEC-----CCccEECcCCc
Confidence            4888  753 33222222     35678999997


No 41 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=23.36  E-value=23  Score=32.50  Aligned_cols=33  Identities=27%  Similarity=0.538  Sum_probs=23.1

Q ss_pred             ccCCCCCc-cccccCCCCCCccceeecCCCCccc
Q 026009          162 VYCCGQPC-LPVGQSDIPRSSTVKIYCPKCEDIY  194 (245)
Q Consensus       162 v~C~~q~l-LPiGlSd~pg~s~VKlyCP~C~DvY  194 (245)
                      --|.||++ ||.+........-=-++||.|.-+-
T Consensus       198 ~~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgRIL  231 (239)
T COG1579         198 RVCGGCHMKLPSQTLSKVRKKDEIVFCPYCGRIL  231 (239)
T ss_pred             CcccCCeeeecHHHHHHHhcCCCCccCCccchHH
Confidence            35777774 7887665555555568999998764


No 42 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=23.21  E-value=27  Score=22.65  Aligned_cols=14  Identities=36%  Similarity=1.355  Sum_probs=11.4

Q ss_pred             eecCCCCccccCCC
Q 026009          185 IYCPKCEDIYYPRS  198 (245)
Q Consensus       185 lyCP~C~DvY~P~s  198 (245)
                      .|||.|+.+-.|+.
T Consensus         2 ~FCp~C~nlL~p~~   15 (35)
T PF02150_consen    2 RFCPECGNLLYPKE   15 (35)
T ss_dssp             -BETTTTSBEEEEE
T ss_pred             eeCCCCCccceEcC
Confidence            48999999998864


No 43 
>PF00471 Ribosomal_L33:  Ribosomal protein L33;  InterPro: IPR001705 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L33 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L33 has been shown to be on the surface of 50S subunit. L33 belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, , ], groups:  Eubacterial L33. Algal and plant chloroplast L33. Cyanelle L33.   L33 is a small protein of 49 to 66 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3PIO_1 3PIP_1 3PYT_3 3MS1_3 3F1F_6 3F1H_6 3MRZ_3 3PYO_3 3D5B_6 3D5D_6 ....
Probab=22.69  E-value=59  Score=22.64  Aligned_cols=17  Identities=35%  Similarity=0.935  Sum_probs=12.8

Q ss_pred             CCCCccceeecCCCCcc
Q 026009          177 IPRSSTVKIYCPKCEDI  193 (245)
Q Consensus       177 ~pg~s~VKlyCP~C~Dv  193 (245)
                      .|..=.++-|||.|+..
T Consensus        25 ~~~rL~lkKycp~~~kh   41 (48)
T PF00471_consen   25 TPERLELKKYCPRCRKH   41 (48)
T ss_dssp             SSSSSEEEEEETSSSSE
T ss_pred             CCceeeEeccCCCCCCE
Confidence            35566789999999753


No 44 
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=22.50  E-value=1.5e+02  Score=19.72  Aligned_cols=40  Identities=20%  Similarity=0.254  Sum_probs=15.4

Q ss_pred             HHHHHHHcCCCCCCCCCCChhhHHHHHHHHHHHhcccccee
Q 026009           97 DYALDLILDVESSHGDMFTEEQNELVESAAEMLYGLIHVRY  137 (245)
Q Consensus        97 ~~aL~~ILd~~~~~~~~~~~~~~~~ie~~A~~LYGLIHARY  137 (245)
                      +.+|++||...+.+...=+....=.++..| .-||+-++||
T Consensus         2 r~~lelll~~H~~dC~~C~~~G~CeLQ~~~-~~~gv~~~~f   41 (41)
T PF10588_consen    2 RTVLELLLANHPLDCPTCDKNGNCELQDLA-YEYGVDEQRF   41 (41)
T ss_dssp             HHHHHHHHTT----TTT-TTGGG-HHHHHH-HHH-S-----
T ss_pred             HHHHHHHHhCCCCcCcCCCCCCCCHHHHHH-HHhCCCcCCC
Confidence            468999998776543221112222333333 3699999987


No 45 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=22.12  E-value=59  Score=23.96  Aligned_cols=16  Identities=44%  Similarity=1.190  Sum_probs=12.5

Q ss_pred             CCCccceeecCCCCcc
Q 026009          178 PRSSTVKIYCPKCEDI  193 (245)
Q Consensus       178 pg~s~VKlyCP~C~Dv  193 (245)
                      |++..|+..||+|.++
T Consensus        19 ~~~~~~~F~CPnCG~~   34 (59)
T PRK14890         19 PREKAVKFLCPNCGEV   34 (59)
T ss_pred             CCCccCEeeCCCCCCe
Confidence            4455789999999765


No 46 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=21.74  E-value=43  Score=22.43  Aligned_cols=12  Identities=42%  Similarity=1.453  Sum_probs=10.1

Q ss_pred             ecCCCCccccCC
Q 026009          186 YCPKCEDIYYPR  197 (245)
Q Consensus       186 yCP~C~DvY~P~  197 (245)
                      |||.|+.+-.++
T Consensus         2 FCp~Cg~~l~~~   13 (52)
T smart00661        2 FCPKCGNMLIPK   13 (52)
T ss_pred             CCCCCCCccccc
Confidence            899999887765


No 47 
>PF08121 Toxin_33:  Waglerin family;  InterPro: IPR012637 This family consists of the lethal peptides (waglerins) that are found in the venom of Trimeresurus wagleri (Wagler's pit viper) (Tropidolaemus wagleri). Waglerins are 22-24 residue lethal peptides and are competitive antagonist of the muscle nicotinic receptor (nAChR). Waglerin-1 possesses a distinctive selectivity for the alpha-epsilon interface binding site of the mouse nAChR [].; GO: 0030550 acetylcholine receptor inhibitor activity, 0005576 extracellular region
Probab=21.59  E-value=55  Score=19.33  Aligned_cols=15  Identities=33%  Similarity=0.658  Sum_probs=11.8

Q ss_pred             CCCCCCCCCCCccee
Q 026009          222 GHLKPQKATQSYVPR  236 (245)
Q Consensus       222 P~l~p~~~~~~Y~Pr  236 (245)
                      |++.|-.++-.|+||
T Consensus         4 pdlrpcyppchyipr   18 (22)
T PF08121_consen    4 PDLRPCYPPCHYIPR   18 (22)
T ss_pred             CccccCCCCccccCC
Confidence            678887777788886


Done!