BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026010
(245 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3OH8|A Chain A, Crystal Structure Of The Nucleoside-Diphosphate Sugar
Epimerase From Corynebacterium Glutamicum. Northeast
Structural Genomics Consortium Target Cgr91
Length = 516
Score = 28.1 bits (61), Expect = 5.0, Method: Compositional matrix adjust.
Identities = 14/39 (35%), Positives = 19/39 (48%)
Query: 79 LQRTKALVECEGESVDLSGDMGAVGRILVPGTAEGNHEM 117
L RT L + +V ++G G VGR L G HE+
Sbjct: 136 LSRTSTLFDGSPLTVAITGSRGLVGRALTAQLQTGGHEV 174
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.128 0.355
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,029,144
Number of Sequences: 62578
Number of extensions: 224558
Number of successful extensions: 447
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 444
Number of HSP's gapped (non-prelim): 4
length of query: 245
length of database: 14,973,337
effective HSP length: 96
effective length of query: 149
effective length of database: 8,965,849
effective search space: 1335911501
effective search space used: 1335911501
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 50 (23.9 bits)