BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026013
         (244 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse
           Polybromo-1
          Length = 120

 Score = 30.4 bits (67), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 10/54 (18%)

Query: 96  GFHNKKLRRLPHIFTRVLELPFRSDADVAVEESPDYFKFVAETDGMGEVRAHMV 149
            + +K+ RRL  IF R   LP RS       E PDY+  + +   M ++R+HM+
Sbjct: 29  NYTDKRGRRLSAIFLR---LPSRS-------ELPDYYLTIKKPMDMEKIRSHMM 72


>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human
           Poly-Bromodomain Containing Protein 1 (Pb1)
 pdb|3G0J|B Chain B, Crystal Structure Of The Fifth Bromodomain Of Human
           Poly-Bromodomain Containing Protein 1 (Pb1)
 pdb|3MB4|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human
           Poly-Bromodomain Containing Protein 1 (Pb1) With Nmp
 pdb|3MB4|B Chain B, Crystal Structure Of The Fifth Bromodomain Of Human
           Poly-Bromodomain Containing Protein 1 (Pb1) With Nmp
          Length = 124

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 10/54 (18%)

Query: 96  GFHNKKLRRLPHIFTRVLELPFRSDADVAVEESPDYFKFVAETDGMGEVRAHMV 149
            + +K+ RRL  IF R   LP RS       E PDY+  + +   M ++R+HM+
Sbjct: 29  NYTDKRGRRLSAIFLR---LPSRS-------ELPDYYLTIKKPMDMEKIRSHMM 72


>pdb|2BYU|A Chain A, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|B Chain B, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|C Chain C, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|D Chain D, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|E Chain E, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|F Chain F, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|G Chain G, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|H Chain H, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|I Chain I, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|J Chain J, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|K Chain K, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
 pdb|2BYU|L Chain L, Negative Stain Em Reconstruction Of M.Tuberculosis
           Acr1(Hsp 16.3) Fitted With Wheat Shsp Dimer
          Length = 101

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 180 RFRLPESTRPELASAVFEDGELIVTVPK 207
           RFRL E  + E   A  E+G L VTVPK
Sbjct: 67  RFRLLEDAKVEEVKAGLENGVLTVTVPK 94


>pdb|2H50|A Chain A, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|B Chain B, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|C Chain C, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|D Chain D, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|E Chain E, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|F Chain F, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|G Chain G, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|H Chain H, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|I Chain I, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|J Chain J, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|K Chain K, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|L Chain L, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|M Chain M, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|N Chain N, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|O Chain O, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|P Chain P, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|Q Chain Q, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|R Chain R, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|S Chain S, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|T Chain T, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|U Chain U, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|V Chain V, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|W Chain W, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H50|X Chain X, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|A Chain A, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|B Chain B, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|C Chain C, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|D Chain D, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|E Chain E, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|F Chain F, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|G Chain G, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|H Chain H, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|I Chain I, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|J Chain J, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|K Chain K, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|L Chain L, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|M Chain M, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|N Chain N, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|O Chain O, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|P Chain P, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|Q Chain Q, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|R Chain R, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|S Chain S, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|T Chain T, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|U Chain U, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|V Chain V, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|W Chain W, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
 pdb|2H53|X Chain X, Multiple Distinct Assemblies Reveal Conformational
           Flexibility In The Small Heat Shock Protein Hsp26
          Length = 93

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 180 RFRLPESTRPELASAVFEDGELIVTVPK 207
           RFRL E  + E   A  E+G L VTVPK
Sbjct: 66  RFRLLEDAKVEEVKAGLENGVLTVTVPK 93


>pdb|1GME|A Chain A, Crystal Structure And Assembly Of An Eukaryotic Small Heat
           Shock Protein
 pdb|1GME|B Chain B, Crystal Structure And Assembly Of An Eukaryotic Small Heat
           Shock Protein
 pdb|1GME|C Chain C, Crystal Structure And Assembly Of An Eukaryotic Small Heat
           Shock Protein
 pdb|1GME|D Chain D, Crystal Structure And Assembly Of An Eukaryotic Small Heat
           Shock Protein
          Length = 151

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 180 RFRLPESTRPELASAVFEDGELIVTVPK 207
           RFRL E  + E   A  E+G L VTVPK
Sbjct: 109 RFRLLEDAKVEEVKAGLENGVLTVTVPK 136


>pdb|1SHS|A Chain A, Small Heat Shock Protein From Methanococcus Jannaschii
 pdb|1SHS|B Chain B, Small Heat Shock Protein From Methanococcus Jannaschii
 pdb|1SHS|C Chain C, Small Heat Shock Protein From Methanococcus Jannaschii
 pdb|1SHS|D Chain D, Small Heat Shock Protein From Methanococcus Jannaschii
 pdb|1SHS|E Chain E, Small Heat Shock Protein From Methanococcus Jannaschii
 pdb|1SHS|F Chain F, Small Heat Shock Protein From Methanococcus Jannaschii
 pdb|1SHS|G Chain G, Small Heat Shock Protein From Methanococcus Jannaschii
 pdb|1SHS|H Chain H, Small Heat Shock Protein From Methanococcus Jannaschii
          Length = 147

 Score = 27.3 bits (59), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 182 RLPESTRPELASAVFEDGELIVTVPK 207
           +LP + + E ASA FE+G L V +PK
Sbjct: 110 KLPATVKEENASAKFENGVLSVILPK 135


>pdb|1E6V|A Chain A, Methyl-Coenzyme M Reductase From Methanopyrus Kandleri
 pdb|1E6V|D Chain D, Methyl-Coenzyme M Reductase From Methanopyrus Kandleri
          Length = 553

 Score = 26.9 bits (58), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 13/17 (76%)

Query: 140 GMGEVRAHMVEIHPGVT 156
           G   V+ HMVEIHPG+T
Sbjct: 145 GGAVVQEHMVEIHPGLT 161


>pdb|4ELD|A Chain A, Crystal Structure Of An Activated Variant Of Small Heat
           Shock Protein Hsp16.5
 pdb|4ELD|B Chain B, Crystal Structure Of An Activated Variant Of Small Heat
           Shock Protein Hsp16.5
          Length = 161

 Score = 26.9 bits (58), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 182 RLPESTRPELASAVFEDGELIVTVPK 207
           +LP + + E ASA FE+G L V +PK
Sbjct: 124 KLPATVKEENASAKFENGVLSVILPK 149


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,964,719
Number of Sequences: 62578
Number of extensions: 146014
Number of successful extensions: 346
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 341
Number of HSP's gapped (non-prelim): 8
length of query: 244
length of database: 14,973,337
effective HSP length: 96
effective length of query: 148
effective length of database: 8,965,849
effective search space: 1326945652
effective search space used: 1326945652
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)