BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026019
(244 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4GRH|A Chain A, Crystal Structure Of Pabb Of Stenotrophomonas Maltophilia
Length = 457
Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust.
Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 4/54 (7%)
Query: 113 PGKGVTNTCEICCRSLLDSFRFCSLGCKLGAM----KRGDLDLTFTLRVKHKDG 162
PG +T ++ C ++ G GA + GDLDL +R DG
Sbjct: 365 PGGTITGCPKVRCMQIISELEQVPRGAYTGAFGWLNRDGDLDLNILIRTAEVDG 418
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.137 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,803,580
Number of Sequences: 62578
Number of extensions: 304844
Number of successful extensions: 595
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 594
Number of HSP's gapped (non-prelim): 2
length of query: 244
length of database: 14,973,337
effective HSP length: 96
effective length of query: 148
effective length of database: 8,965,849
effective search space: 1326945652
effective search space used: 1326945652
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)