Citrus Sinensis ID: 026029

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----

MPLTTANFSICPSIFLRRIRVRSPSPKFPPRFSQFSISRPNLTSPSAAMLLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGKETESLCMPVLSSLFTGLSAVQYLNLFSCKLDIKNCICTFTDIFAINYCS

ccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccHHHHHHcccHHEEEEEcccccccccccEEEEccEEEEcccc

*****ANFSICPSIFLRRIRV****************************LLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGKETESLCMPVLSSLFTGLSAVQYLNLFSCKLDIKNCICTFTDIFAINYCS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable phytol kinase 2, chloroplastic	Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytolmonophosphate (PMP).	probable	Q67ZM7

Prediction of Enzyme Commission Number

No confident prediction of EC number!