BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026046
(244 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3HK0|A Chain A, Crystal Structure Of The Ra And Ph Domains Of Grb10
pdb|3HK0|B Chain B, Crystal Structure Of The Ra And Ph Domains Of Grb10
Length = 256
Score = 29.6 bits (65), Expect = 1.8, Method: Compositional matrix adjust.
Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 6/51 (11%)
Query: 147 FPQVKFVPSPLGKLPRNQVNPEQLETFMAQETGKRRQLLQKFLDTCSQSKV 197
+ + +F +P+ P EQ+ T+ Q G + QLLQ FL++ S ++
Sbjct: 90 YAKYEFFKNPMNFFP------EQMVTWSQQSNGSQTQLLQNFLNSSSSPEI 134
>pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl
Pyrophosphate Synthase
pdb|3APZ|B Chain B, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl
Pyrophosphate Synthase
Length = 348
Score = 28.9 bits (63), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 12/33 (36%), Positives = 20/33 (60%)
Query: 131 LRHAVNPSTLIFLIHVFPQVKFVPSPLGKLPRN 163
+RH V + ++F + FPQ++ V + K PRN
Sbjct: 254 IRHGVITAPILFAMEEFPQLREVVDQVEKDPRN 286
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.132 0.365
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,353,145
Number of Sequences: 62578
Number of extensions: 184422
Number of successful extensions: 394
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 390
Number of HSP's gapped (non-prelim): 4
length of query: 244
length of database: 14,973,337
effective HSP length: 96
effective length of query: 148
effective length of database: 8,965,849
effective search space: 1326945652
effective search space used: 1326945652
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)