Citrus Sinensis ID: 026073

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----

MEEKLLRDLTREICSLLSTMASSGLNNGIPPIEQSGHFNRVDVLFLKDLDAFASKSMVGFLLKHKDLALPALQISLEAFTWTDGEAVTKVSSFCSAVVLLAIQSNNIELQQFVSKDLFSAIIRGLALESNAVISADLVGLCREIFIYMCDRDPAPRQVLLSLPCITPQDLLAFEDALTKTASPREQKQHMRSLLVSGTGNNLKALAAQKSVNVITNVSTRPRSSDNAPENRTEEGESIGLAAIS

cHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccccccccccccccccc

MEEKLLRDLTREICSLLSTMASSGLN***************DVLFLKDLDAFASKSMVGFLLKHKDLALPALQISLEAFTWTDGEAVTKVSSFCSAVVLLAIQSNNIELQQFVSKDLFSAIIRGLALESNAVISADLVGLCREIFIYMCDRDPAPRQVLLSLPCITPQDLLAFEDAL*************RSLLVSGTG*********************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein HASTY 1	Nucleocytoplasmic transporter involved in the nuclear export of microRNAs (miRNAs). Required for several miRNAs accumulation. Specifically required for miR156 accumulation which targets SPL3, SPL4 and SPL5 transcription factors. Involved in plant development through its role in miRNAs processing. Required for vegetative phase change and vegetative to reproductive phase transition. Functionally dependent on RAN1 binding. Does not seem to be involved in small interfering RNAs (siRNAs) processing.	probable	Q0WP44

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X19, chain B
Confidence level:probable
Coverage over the Query: 68-200
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3a6p, chain A		very confident	Alignment \| Template Structure