BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026096
         (243 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ALX|A Chain A, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|B Chain B, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|C Chain C, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|D Chain D, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|E Chain E, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|F Chain F, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|G Chain G, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|H Chain H, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|I Chain I, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
 pdb|4ALX|J Chain J, Crystal Structure Of Ls-Achbp Complexed With The Potent
           Nachr Antagonist Dhbe
          Length = 229

 Score = 30.4 bits (67), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 11/74 (14%)

Query: 72  NMYCLDCMNGALCSLCLSLHRDHRAIQIRRSSYHDVI--------RVSEIQKYLDITGVQ 123
           N++CL C+   +   CLSL R      IR++S  DVI         VS   K+++I  V 
Sbjct: 4   NIFCLACL--WIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVN 61

Query: 124 TYIINSARIVFLNE 137
             I N   +VF  +
Sbjct: 62  E-ITNEVDVVFWQQ 74


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.135    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,953,743
Number of Sequences: 62578
Number of extensions: 198468
Number of successful extensions: 370
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 370
Number of HSP's gapped (non-prelim): 1
length of query: 243
length of database: 14,973,337
effective HSP length: 96
effective length of query: 147
effective length of database: 8,965,849
effective search space: 1317979803
effective search space used: 1317979803
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)