Query         026096
Match_columns 243
No_of_seqs    146 out of 195
Neff          3.9 
Searched_HMMs 46136
Date          Fri Mar 29 03:43:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026096.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026096hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04640 PLATZ:  PLATZ transcri 100.0 1.1E-39 2.3E-44  245.7   6.0   72  100-171     1-72  (72)
  2 PF00643 zf-B_box:  B-box zinc   96.4 0.00091   2E-08   44.1   0.4   37   59-99      5-42  (42)
  3 cd00021 BBOX B-Box-type zinc f  94.8   0.017 3.8E-07   36.8   1.5   36   59-98      2-38  (39)
  4 smart00336 BBOX B-Box-type zin  93.6    0.05 1.1E-06   35.1   1.9   35   59-97      5-40  (42)
  5 PRK01343 zinc-binding protein;  87.2    0.25 5.4E-06   36.4   0.7   29  148-176     9-38  (57)
  6 PF12855 Ecl1:  Life-span regul  86.0    0.18 3.9E-06   35.0  -0.5   29  148-176     6-37  (43)
  7 PF03884 DUF329:  Domain of unk  85.5     0.1 2.3E-06   38.2  -2.0   29  148-176     2-35  (57)
  8 PRK00418 DNA gyrase inhibitor;  84.5    0.35 7.6E-06   36.1   0.4   29  148-176     6-39  (62)
  9 COG3024 Uncharacterized protei  83.9    0.39 8.4E-06   36.3   0.4   29  148-176     7-40  (65)
 10 PF10013 DUF2256:  Uncharacteri  73.7     1.1 2.4E-05   31.2   0.1   23  148-170     8-39  (42)
 11 PF09889 DUF2116:  Uncharacteri  65.8     1.8 3.8E-05   32.0  -0.3   30  149-178     4-33  (59)
 12 PF13240 zinc_ribbon_2:  zinc-r  62.9     3.5 7.7E-05   24.9   0.7   16  151-166     2-17  (23)
 13 PF02207 zf-UBR:  Putative zinc  57.3     4.9 0.00011   29.7   0.8   33   70-102    11-48  (71)
 14 KOG4367 Predicted Zn-finger pr  55.3     3.9 8.5E-05   41.4  -0.0   36   57-96    223-260 (699)
 15 PF13248 zf-ribbon_3:  zinc-rib  54.0     7.3 0.00016   23.8   1.1   19  148-166     2-20  (26)
 16 cd02340 ZZ_NBR1_like Zinc fing  52.7     8.6 0.00019   26.2   1.3   27   73-99     15-43  (43)
 17 COG4338 Uncharacterized protei  51.3     1.4 3.1E-05   32.0  -2.8   24  147-170    11-43  (54)
 18 PF06467 zf-FCS:  MYM-type Zinc  47.8     4.1   9E-05   26.6  -0.8   24  147-170     5-40  (43)
 19 KOG2177 Predicted E3 ubiquitin  45.3      11 0.00023   31.2   1.1   38   59-101    88-127 (386)
 20 PF01412 ArfGap:  Putative GTPa  38.6     8.5 0.00018   30.8  -0.5   50   70-119    11-72  (116)
 21 COG4068 Uncharacterized protei  37.1      11 0.00024   28.3   0.0   23  148-170     8-30  (64)
 22 KOG0006 E3 ubiquitin-protein l  35.8      21 0.00046   34.9   1.6   45   22-79    173-228 (446)
 23 PF04438 zf-HIT:  HIT zinc fing  33.1      12 0.00027   23.9  -0.3   21  150-170     4-29  (30)
 24 cd02341 ZZ_ZZZ3 Zinc finger, Z  29.0      34 0.00075   24.0   1.4   27   73-99     16-48  (48)
 25 smart00105 ArfGap Putative GTP  28.5      16 0.00034   29.1  -0.5   42   72-114     3-57  (112)
 26 PF04570 DUF581:  Protein of un  26.6      21 0.00045   26.3  -0.1   29  147-175    15-52  (58)
 27 smart00396 ZnF_UBR1 Putative z  25.3      73  0.0016   23.7   2.6   29   67-95      8-41  (71)
 28 TIGR00412 redox_disulf_2 small  23.8   1E+02  0.0022   22.3   3.2   32  107-139    33-66  (76)
 29 PF06156 DUF972:  Protein of un  21.4      59  0.0013   26.4   1.6   31   46-77     76-107 (107)
 30 smart00746 TRASH metallochaper  21.2      54  0.0012   18.4   1.0   11  161-171    23-33  (39)
 31 PF08002 DUF1697:  Protein of u  21.1      55  0.0012   27.1   1.4   30  105-135    16-48  (137)
 32 PRK05707 DNA polymerase III su  21.0   1E+02  0.0022   29.0   3.3   92   44-136     4-113 (328)
 33 KOG2807 RNA polymerase II tran  20.7      42  0.0009   32.9   0.7   19   70-88    351-374 (378)
 34 KOG4582 Uncharacterized conser  20.2      68  0.0015   29.8   1.9   57   42-101   131-199 (278)

No 1  
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=100.00  E-value=1.1e-39  Score=245.75  Aligned_cols=72  Identities=65%  Similarity=1.157  Sum_probs=71.1

Q ss_pred             EeccccceeecchhhhhhcccceeeEEecCceEEEeeCCCCCCCCCCCCCcccccccccCCCCeeeeccccc
Q 026096          100 RRSSYHDVIRVSEIQKYLDITGVQTYIINSARIVFLNERPQPRPGKGVTNTCLVCERSLLDSFTFCSLGCKI  171 (243)
Q Consensus       100 RRssYhdVVRv~DIqkllD~S~IQtYvINsakVVFLn~RPq~r~~kg~~~~Ce~C~R~L~D~~rFCSL~CKv  171 (243)
                      |||||||||||+|||||||||+||||+|||+||||||+|||+++++++++.|++|+|+|+|+|+||||+|||
T Consensus         1 Rr~sY~dVVrv~di~kl~D~s~IQtY~iNs~kVVfLn~Rpq~~~~~~~~~~C~~C~R~L~d~~~fCSl~CKv   72 (72)
T PF04640_consen    1 RRYSYHDVVRVSDIQKLLDCSGIQTYVINSAKVVFLNPRPQSRPSKGSGNICETCHRSLQDPYRFCSLSCKV   72 (72)
T ss_pred             CcccccceEEHHHhHhhccccccEEEEeCCceEEEEccCCcCCCCCCCCCccCCCCCCCCCCCeEEeeeEEC
Confidence            799999999999999999999999999999999999999999999999999999999999999999999997


No 2  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.45  E-value=0.00091  Score=44.11  Aligned_cols=37  Identities=32%  Similarity=0.820  Sum_probs=29.4

Q ss_pred             cccccccCCCCCcceeccccCCCcCCccccc-cCCCCceeEE
Q 026096           59 QCKLHADAHKSECNMYCLDCMNGALCSLCLS-LHRDHRAIQI   99 (243)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~-~H~~HrvlQI   99 (243)
                      .|..|..   ...++||.+|. ..+|..|.. .|++|.++.|
T Consensus         5 ~C~~H~~---~~~~~~C~~C~-~~~C~~C~~~~H~~H~~~~i   42 (42)
T PF00643_consen    5 KCPEHPE---EPLSLFCEDCN-EPLCSECTVSGHKGHKIVPI   42 (42)
T ss_dssp             B-SSTTT---SBEEEEETTTT-EEEEHHHHHTSTTTSEEEEC
T ss_pred             cCccCCc---cceEEEecCCC-CccCccCCCCCCCCCEEeEC
Confidence            5888875   23789999998 899999977 5999987754


No 3  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=94.75  E-value=0.017  Score=36.80  Aligned_cols=36  Identities=25%  Similarity=0.588  Sum_probs=27.6

Q ss_pred             cccccccCCCCCcceeccccCCCcCCccccc-cCCCCceeE
Q 026096           59 QCKLHADAHKSECNMYCLDCMNGALCSLCLS-LHRDHRAIQ   98 (243)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~-~H~~HrvlQ   98 (243)
                      .|+.|..   +...+||.+|. ..+|..|.. .|++|.++-
T Consensus         2 ~C~~H~~---~~~~~fC~~~~-~~iC~~C~~~~H~~H~~~~   38 (39)
T cd00021           2 LCDEHGE---EPLSLFCETDR-ALLCVDCDLSVHSGHRRVP   38 (39)
T ss_pred             CCCccCC---cceEEEeCccC-hhhhhhcChhhcCCCCEee
Confidence            4777753   23589999997 899999965 688887654


No 4  
>smart00336 BBOX B-Box-type zinc finger.
Probab=93.59  E-value=0.05  Score=35.12  Aligned_cols=35  Identities=31%  Similarity=0.836  Sum_probs=27.4

Q ss_pred             cccccccCCCCCcceeccccCCCcCCccccc-cCCCCcee
Q 026096           59 QCKLHADAHKSECNMYCLDCMNGALCSLCLS-LHRDHRAI   97 (243)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~-~H~~Hrvl   97 (243)
                      .|..|..   ....+||.+|. ..+|..|.. .|++|.++
T Consensus         5 ~C~~h~~---~~~~~~C~~c~-~~iC~~C~~~~H~~H~~~   40 (42)
T smart00336        5 KCDSHGD---EPAEFFCEECG-ALLCRTCDEAEHRGHTVV   40 (42)
T ss_pred             cCCCCCC---CceEEECCCCC-cccccccChhhcCCCcee
Confidence            4777763   23589999998 889999976 58888765


No 5  
>PRK01343 zinc-binding protein; Provisional
Probab=87.21  E-value=0.25  Score=36.38  Aligned_cols=29  Identities=24%  Similarity=0.543  Sum_probs=23.1

Q ss_pred             CCcccccccccCCCC-eeeecccccccccc
Q 026096          148 TNTCLVCERSLLDSF-TFCSLGCKIAGTSK  176 (243)
Q Consensus       148 ~~~Ce~C~R~L~D~~-rFCSL~CKv~~~~~  176 (243)
                      ...|-+|++.....+ -|||-.||..+..+
T Consensus         9 ~~~CP~C~k~~~~~~rPFCS~RC~~iDLg~   38 (57)
T PRK01343          9 TRPCPECGKPSTREAYPFCSERCRDIDLNR   38 (57)
T ss_pred             CCcCCCCCCcCcCCCCcccCHHHhhhhHHH
Confidence            456999999887655 59999999876553


No 6  
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=86.03  E-value=0.18  Score=35.01  Aligned_cols=29  Identities=28%  Similarity=0.812  Sum_probs=24.1

Q ss_pred             CCccccccccc---CCCCeeeecccccccccc
Q 026096          148 TNTCLVCERSL---LDSFTFCSLGCKIAGTSK  176 (243)
Q Consensus       148 ~~~Ce~C~R~L---~D~~rFCSL~CKv~~~~~  176 (243)
                      .+.|.+|+|-+   .+...|||-.|++.+...
T Consensus         6 ~~yC~~Cdk~~~~~~~~~lYCSe~Cr~~D~~~   37 (43)
T PF12855_consen    6 NDYCIVCDKQIDPPDDGSLYCSEECRLKDQEK   37 (43)
T ss_pred             hhHHHHhhccccCCCCCccccCHHHHhHhhhc
Confidence            56799999999   678999999999865543


No 7  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=85.50  E-value=0.1  Score=38.22  Aligned_cols=29  Identities=31%  Similarity=0.724  Sum_probs=17.8

Q ss_pred             CCcccccccccCC----CCe-eeecccccccccc
Q 026096          148 TNTCLVCERSLLD----SFT-FCSLGCKIAGTSK  176 (243)
Q Consensus       148 ~~~Ce~C~R~L~D----~~r-FCSL~CKv~~~~~  176 (243)
                      +..|-+|++...-    +|+ |||-.||+.+..+
T Consensus         2 ~v~CP~C~k~~~~~~~n~~rPFCS~RCk~iDLg~   35 (57)
T PF03884_consen    2 TVKCPICGKPVEWSPENPFRPFCSERCKLIDLGR   35 (57)
T ss_dssp             EEE-TTT--EEE-SSSSS--SSSSHHHHHHHHS-
T ss_pred             cccCCCCCCeecccCCCCcCCcccHhhcccCHHH
Confidence            3469999998875    676 9999999876654


No 8  
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=84.51  E-value=0.35  Score=36.14  Aligned_cols=29  Identities=28%  Similarity=0.681  Sum_probs=22.5

Q ss_pred             CCcccccccccC---C-CCe-eeecccccccccc
Q 026096          148 TNTCLVCERSLL---D-SFT-FCSLGCKIAGTSK  176 (243)
Q Consensus       148 ~~~Ce~C~R~L~---D-~~r-FCSL~CKv~~~~~  176 (243)
                      .-.|-+|++.+.   + +|+ |||-.||+.+..+
T Consensus         6 ~v~CP~C~k~~~w~~~~~~rPFCS~RCk~IDLg~   39 (62)
T PRK00418          6 TVNCPTCGKPVEWGEISPFRPFCSKRCQLIDLGE   39 (62)
T ss_pred             cccCCCCCCcccccCCCCcCCcccHHHHhhhHHH
Confidence            456999999874   3 575 9999999876553


No 9  
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=83.87  E-value=0.39  Score=36.31  Aligned_cols=29  Identities=31%  Similarity=0.732  Sum_probs=22.9

Q ss_pred             CCcccccccccCC----CCe-eeecccccccccc
Q 026096          148 TNTCLVCERSLLD----SFT-FCSLGCKIAGTSK  176 (243)
Q Consensus       148 ~~~Ce~C~R~L~D----~~r-FCSL~CKv~~~~~  176 (243)
                      +-.|-+|++.+.-    +|| |||-.||+-+..+
T Consensus         7 ~v~CP~Cgkpv~w~~~s~frPFCSkRCklIDLg~   40 (65)
T COG3024           7 TVPCPTCGKPVVWGEESPFRPFCSKRCKLIDLGE   40 (65)
T ss_pred             cccCCCCCCcccccccCCcCcchhHhhhhcchhh
Confidence            3459999998864    666 9999999876654


No 10 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=73.70  E-value=1.1  Score=31.24  Aligned_cols=23  Identities=35%  Similarity=0.925  Sum_probs=19.8

Q ss_pred             CCcccccccccC---------CCCeeeecccc
Q 026096          148 TNTCLVCERSLL---------DSFTFCSLGCK  170 (243)
Q Consensus       148 ~~~Ce~C~R~L~---------D~~rFCSL~CK  170 (243)
                      ..+|.+|+|.+.         |..+|||-.|.
T Consensus         8 ~K~C~~C~rpf~WRKKW~~~Wd~VkYCS~rCR   39 (42)
T PF10013_consen    8 SKICPVCGRPFTWRKKWARCWDEVKYCSDRCR   39 (42)
T ss_pred             CCcCcccCCcchHHHHHHHhchhhccHHHHhc
Confidence            457999999996         57899999996


No 11 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=65.83  E-value=1.8  Score=31.99  Aligned_cols=30  Identities=23%  Similarity=0.552  Sum_probs=24.7

Q ss_pred             CcccccccccCCCCeeeeccccccccccch
Q 026096          149 NTCLVCERSLLDSFTFCSLGCKIAGTSKNF  178 (243)
Q Consensus       149 ~~Ce~C~R~L~D~~rFCSL~CKv~~~~~~~  178 (243)
                      .+|..||..+...-.|||-.|+-...+++.
T Consensus         4 kHC~~CG~~Ip~~~~fCS~~C~~~~~k~qk   33 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFCSPKCREEYRKRQK   33 (59)
T ss_pred             CcCCcCCCcCCcchhhhCHHHHHHHHHHHH
Confidence            579999999999999999999965555443


No 12 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=62.95  E-value=3.5  Score=24.85  Aligned_cols=16  Identities=31%  Similarity=0.816  Sum_probs=14.4

Q ss_pred             ccccccccCCCCeeee
Q 026096          151 CLVCERSLLDSFTFCS  166 (243)
Q Consensus       151 Ce~C~R~L~D~~rFCS  166 (243)
                      |..|+..+.+...||+
T Consensus         2 Cp~CG~~~~~~~~fC~   17 (23)
T PF13240_consen    2 CPNCGAEIEDDAKFCP   17 (23)
T ss_pred             CcccCCCCCCcCcchh
Confidence            7889999999999986


No 13 
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=57.26  E-value=4.9  Score=29.67  Aligned_cols=33  Identities=30%  Similarity=0.658  Sum_probs=23.5

Q ss_pred             CcceeccccCC---CcCCccc-cc-cCCCCceeEEEec
Q 026096           70 ECNMYCLDCMN---GALCSLC-LS-LHRDHRAIQIRRS  102 (243)
Q Consensus        70 E~N~FCldC~~---~~lC~~C-l~-~H~~HrvlQIRRs  102 (243)
                      +--..|++|..   .++|..| .. .|.+|+++.++-.
T Consensus        11 q~~y~C~tC~~~~~~~iC~~CF~~~~H~gH~~~~~~~~   48 (71)
T PF02207_consen   11 QIFYRCLTCSLDESSGICEECFANSCHEGHRVVYYRSS   48 (71)
T ss_dssp             -EEEEETTTBSSTT-BBEHHHHCTSGGGGSSEEEEE--
T ss_pred             CEEEECccCCCCCCEEEchhhCCCCCcCCCcEEEEEeC
Confidence            55678999974   5799999 54 8999998777654


No 14 
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=55.28  E-value=3.9  Score=41.36  Aligned_cols=36  Identities=31%  Similarity=0.731  Sum_probs=27.9

Q ss_pred             cccccccccCCCCCcceeccccCCCcCCccccc--cCCCCce
Q 026096           57 FVQCKLHADAHKSECNMYCLDCMNGALCSLCLS--LHRDHRA   96 (243)
Q Consensus        57 F~~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~--~H~~Hrv   96 (243)
                      -..|..|....   ..|||+.|. .++|..|+.  .|..|.|
T Consensus       223 ~~~ct~h~~e~---~smyc~~ck-~pvc~~clee~khs~hev  260 (699)
T KOG4367|consen  223 VSTCTDHELEN---HSMYCVQCK-MPVCYQCLEEGKHSSHEV  260 (699)
T ss_pred             hhhccCCCCCC---ceEEEEecC-ChHHHHHHHhhcccchhh
Confidence            45688887532   479999998 899999997  6777753


No 15 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=54.02  E-value=7.3  Score=23.75  Aligned_cols=19  Identities=21%  Similarity=0.494  Sum_probs=15.9

Q ss_pred             CCcccccccccCCCCeeee
Q 026096          148 TNTCLVCERSLLDSFTFCS  166 (243)
Q Consensus       148 ~~~Ce~C~R~L~D~~rFCS  166 (243)
                      ...|..|+..+.+..+||+
T Consensus         2 ~~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             cCCCcccCCcCCcccccCh
Confidence            3568999998888899996


No 16 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=52.68  E-value=8.6  Score=26.21  Aligned_cols=27  Identities=33%  Similarity=0.781  Sum_probs=20.3

Q ss_pred             eeccccCCCcCCccccc--cCCCCceeEE
Q 026096           73 MYCLDCMNGALCSLCLS--LHRDHRAIQI   99 (243)
Q Consensus        73 ~FCldC~~~~lC~~Cl~--~H~~HrvlQI   99 (243)
                      .-|+.|.+--||..|..  .|..|+.++|
T Consensus        15 y~C~~C~d~dLC~~C~~~~~H~~H~f~~~   43 (43)
T cd02340          15 YKCLVCPDYDLCESCEAKGVHPEHAMLKI   43 (43)
T ss_pred             EECCCCCCccchHHhhCcCCCCCCCEEeC
Confidence            55888877889999955  5777776653


No 17 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=51.30  E-value=1.4  Score=31.96  Aligned_cols=24  Identities=33%  Similarity=0.881  Sum_probs=20.7

Q ss_pred             CCCcccccccccC---------CCCeeeecccc
Q 026096          147 VTNTCLVCERSLL---------DSFTFCSLGCK  170 (243)
Q Consensus       147 ~~~~Ce~C~R~L~---------D~~rFCSL~CK  170 (243)
                      ....|++|+|.+.         |...|||-.|+
T Consensus        11 p~KICpvCqRPFsWRkKW~~cWDeVKyCSeRCr   43 (54)
T COG4338          11 PDKICPVCQRPFSWRKKWARCWDEVKYCSERCR   43 (54)
T ss_pred             chhhhhhhcCchHHHHHHHHHHHHHHHHHHHHH
Confidence            4678999999985         57899999998


No 18 
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=47.82  E-value=4.1  Score=26.62  Aligned_cols=24  Identities=29%  Similarity=0.715  Sum_probs=15.0

Q ss_pred             CCCcccccccccCC-C-----------Ceeeecccc
Q 026096          147 VTNTCLVCERSLLD-S-----------FTFCSLGCK  170 (243)
Q Consensus       147 ~~~~Ce~C~R~L~D-~-----------~rFCSL~CK  170 (243)
                      ....|..|++.+.. +           ..|||..|.
T Consensus         5 ~~~~C~~C~~~~~~~~~~~~~~~~g~~~~FCS~~C~   40 (43)
T PF06467_consen    5 KMKTCSYCKKYIPNKPTMIEVQYDGKMKQFCSQSCL   40 (43)
T ss_dssp             SCEE-TTT--EEECCC----EE-TTTTSCCSSHHHH
T ss_pred             cCCcCcccCCcccCCCccccccccCcccChhCHHHH
Confidence            45689999877743 2           379999985


No 19 
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=45.33  E-value=11  Score=31.18  Aligned_cols=38  Identities=29%  Similarity=0.691  Sum_probs=30.1

Q ss_pred             cccccccCCCCCcceeccccCCCcCCcccc-c-cCCCCceeEEEe
Q 026096           59 QCKLHADAHKSECNMYCLDCMNGALCSLCL-S-LHRDHRAIQIRR  101 (243)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~lC~~Cl-~-~H~~HrvlQIRR  101 (243)
                      .|..|...    ..+||..|. ..+|..|. . .|..|.++.+..
T Consensus        88 ~c~~~~~~----~~~~c~~~~-~~~c~~c~~~~~h~~h~~~~~~~  127 (386)
T KOG2177|consen   88 LCEKHGEE----LKLFCEEDE-KLLCVLCRESGEHRGHPVLPLEE  127 (386)
T ss_pred             hhhhcCCc----ceEEecccc-cccCCCCCCcccccCCccccHHH
Confidence            78877753    679999997 78999996 3 899998776554


No 20 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=38.61  E-value=8.5  Score=30.80  Aligned_cols=50  Identities=28%  Similarity=0.358  Sum_probs=29.2

Q ss_pred             CcceeccccC-----------CCcCCccccccCCCCc-eeEEEeccccceeecchhhhhhcc
Q 026096           70 ECNMYCLDCM-----------NGALCSLCLSLHRDHR-AIQIRRSSYHDVIRVSEIQKYLDI  119 (243)
Q Consensus        70 E~N~FCldC~-----------~~~lC~~Cl~~H~~Hr-vlQIRRssYhdVVRv~DIqkllD~  119 (243)
                      .-|..|.||.           +.-+|..|...|+.-. .+-.-|+.-.|-...+||+.+...
T Consensus        11 ~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~VkSi~~d~w~~~ev~~~~~~   72 (116)
T PF01412_consen   11 PGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRVKSITMDNWSPEEVQRMREG   72 (116)
T ss_dssp             TTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--EEETTTS---HHHHHHHHHS
T ss_pred             cCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhccccccCCCCHHHHHHHHHH
Confidence            4588899995           2248999988787421 223337777888888888887654


No 21 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=37.07  E-value=11  Score=28.32  Aligned_cols=23  Identities=26%  Similarity=0.694  Sum_probs=21.0

Q ss_pred             CCcccccccccCCCCeeeecccc
Q 026096          148 TNTCLVCERSLLDSFTFCSLGCK  170 (243)
Q Consensus       148 ~~~Ce~C~R~L~D~~rFCSL~CK  170 (243)
                      ..+|.+|+..+...-+|||-.|.
T Consensus         8 H~HC~VCg~aIp~de~~CSe~C~   30 (64)
T COG4068           8 HRHCVVCGKAIPPDEQVCSEECG   30 (64)
T ss_pred             CccccccCCcCCCccchHHHHHH
Confidence            45799999999999999999997


No 22 
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones]
Probab=35.84  E-value=21  Score=34.94  Aligned_cols=45  Identities=33%  Similarity=0.575  Sum_probs=31.4

Q ss_pred             cccccccCCCCCCchhhhhcCCCCCcHHHHhcccccccccccccCCC-----------CCcceeccccC
Q 026096           22 PKNRRIMGGGGPEEEDEEMSNKWPPWLRPLLQTSFFVQCKLHADAHK-----------SECNMYCLDCM   79 (243)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~~P~WL~~LL~~~FF~~C~~H~~~~k-----------nE~N~FCldC~   79 (243)
                      +|+|||-|  .++.-+      .|-     |..+||=.|..|.++-|           |-+|+-|+.|.
T Consensus       173 Lks~Ripg--~Ces~~------~pg-----~fAEFfFKC~ah~~~~k~~aa~lhli~~N~~ni~C~~Ct  228 (446)
T KOG0006|consen  173 LKSKRIPG--VCESCC------TPG-----LFAEFFFKCGAHPTSDKETAAALHLIATNSRNITCITCT  228 (446)
T ss_pred             hhcccCcc--cccccc------CCc-----chHhheehhccCCCccccchhHHHHhhcccccceeEEec
Confidence            67888855  122212      343     66789999999997633           67899999996


No 23 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=33.05  E-value=12  Score=23.86  Aligned_cols=21  Identities=33%  Similarity=0.746  Sum_probs=12.3

Q ss_pred             cccccccccC-----CCCeeeecccc
Q 026096          150 TCLVCERSLL-----DSFTFCSLGCK  170 (243)
Q Consensus       150 ~Ce~C~R~L~-----D~~rFCSL~CK  170 (243)
                      .|.+|+..-.     -..+||||.|.
T Consensus         4 ~C~vC~~~~kY~Cp~C~~~~CSl~C~   29 (30)
T PF04438_consen    4 LCSVCGNPAKYRCPRCGARYCSLACY   29 (30)
T ss_dssp             EETSSSSEESEE-TTT--EESSHHHH
T ss_pred             CCccCcCCCEEECCCcCCceeCcEeE
Confidence            4677776211     14689999984


No 24 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=29.00  E-value=34  Score=23.98  Aligned_cols=27  Identities=33%  Similarity=0.751  Sum_probs=18.8

Q ss_pred             eeccccC--CCcCCccccc---cCC-CCceeEE
Q 026096           73 MYCLDCM--NGALCSLCLS---LHR-DHRAIQI   99 (243)
Q Consensus        73 ~FCldC~--~~~lC~~Cl~---~H~-~HrvlQI   99 (243)
                      .-|++|.  +--||..|..   .|. +|+.+.|
T Consensus        16 ~~C~~C~~~d~DlC~~C~~~~~~H~~~H~~~~i   48 (48)
T cd02341          16 YHCSECDDGDFDLCQDCVVKGESHQEDHWLVKI   48 (48)
T ss_pred             EECCCCCCCCCccCHHHHhCcCCCCCCCceeeC
Confidence            5588888  7789999954   343 5766654


No 25 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=28.52  E-value=16  Score=29.13  Aligned_cols=42  Identities=31%  Similarity=0.483  Sum_probs=26.9

Q ss_pred             ceeccccCC-----------CcCCccccccCCCC--ceeEEEeccccceeecchhh
Q 026096           72 NMYCLDCMN-----------GALCSLCLSLHRDH--RAIQIRRSSYHDVIRVSEIQ  114 (243)
Q Consensus        72 N~FCldC~~-----------~~lC~~Cl~~H~~H--rvlQIRRssYhdVVRv~DIq  114 (243)
                      |..|.||..           .-+|..|...|+..  ++-. .|+.-.|...-++|+
T Consensus         3 N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~-VkSl~md~w~~~~i~   57 (112)
T smart00105        3 NKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISK-VRSLTLDTWTEEELR   57 (112)
T ss_pred             CCcccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCe-eeecccCCCCHHHHH
Confidence            788999962           23789998888864  2222 445556665556664


No 26 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=26.57  E-value=21  Score=26.31  Aligned_cols=29  Identities=28%  Similarity=0.686  Sum_probs=21.7

Q ss_pred             CCCcccccccccC---CC--Ce----eeeccccccccc
Q 026096          147 VTNTCLVCERSLL---DS--FT----FCSLGCKIAGTS  175 (243)
Q Consensus       147 ~~~~Ce~C~R~L~---D~--~r----FCSL~CKv~~~~  175 (243)
                      .-..|-.|.|.|.   |.  |+    |||..|.-..|.
T Consensus        15 FL~~C~~C~k~L~~~~DiymYrGd~aFCS~ECR~~qi~   52 (58)
T PF04570_consen   15 FLSFCYLCKKKLDPGKDIYMYRGDKAFCSEECRSQQIL   52 (58)
T ss_pred             HHHHHHccCCCCCCCCCeeeeccccccccHHHHHHHHH
Confidence            3468999999998   32  33    999999865554


No 27 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=25.28  E-value=73  Score=23.70  Aligned_cols=29  Identities=31%  Similarity=0.579  Sum_probs=21.1

Q ss_pred             CCCCcceeccccCC---CcCCccccc--cCCCCc
Q 026096           67 HKSECNMYCLDCMN---GALCSLCLS--LHRDHR   95 (243)
Q Consensus        67 ~knE~N~FCldC~~---~~lC~~Cl~--~H~~Hr   95 (243)
                      .++|.-..|++|..   ..+|..|..  .|.+|+
T Consensus         8 ~~~~~~y~C~tC~~~~~~~iC~~Cf~~~~H~gH~   41 (71)
T smart00396        8 TGGEVIYRCKTCGLDPTCVLCSDCFRSNCHKGHD   41 (71)
T ss_pred             CCCCEEEECcCCCCCCCEeEChHHCCCCCCCCCC
Confidence            34566688999973   358888854  799998


No 28 
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=23.75  E-value=1e+02  Score=22.30  Aligned_cols=32  Identities=9%  Similarity=0.318  Sum_probs=22.5

Q ss_pred             eeecchhhhh--hcccceeeEEecCceEEEeeCCC
Q 026096          107 VIRVSEIQKY--LDITGVQTYIINSARIVFLNERP  139 (243)
Q Consensus       107 VVRv~DIqkl--lD~S~IQtYvINsakVVFLn~RP  139 (243)
                      +++++|+...  +++.+|-|.++||..+ +....|
T Consensus        33 ~~~v~~~~~a~~~~v~~vPti~i~G~~~-~~G~~~   66 (76)
T TIGR00412        33 FEKVTDMNEILEAGVTATPGVAVDGELV-IMGKIP   66 (76)
T ss_pred             EEEeCCHHHHHHcCCCcCCEEEECCEEE-EEeccC
Confidence            5666655554  7999999999988655 554434


No 29 
>PF06156 DUF972:  Protein of unknown function (DUF972);  InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication. SUBUNIT: Interacts with both DnaA and DnaN, acting as a bridge between these two proteins. SIMILARITY: Belongs to the YabA family.
Probab=21.44  E-value=59  Score=26.35  Aligned_cols=31  Identities=29%  Similarity=0.578  Sum_probs=25.2

Q ss_pred             CcHHHHhcccccccccccccCCC-CCcceeccc
Q 026096           46 PWLRPLLQTSFFVQCKLHADAHK-SECNMYCLD   77 (243)
Q Consensus        46 ~WL~~LL~~~FF~~C~~H~~~~k-nE~N~FCld   77 (243)
                      .=|..|..+- |=-|..|.+.++ +|-.+||++
T Consensus        76 ~NL~~LY~EG-FHICn~~yG~~R~~edClFCl~  107 (107)
T PF06156_consen   76 DNLARLYQEG-FHICNVHYGSRRNDEDCLFCLS  107 (107)
T ss_pred             HHHHHHHhcC-eeeCcHHhCCcCCCCCCcccCC
Confidence            5688888888 788999998888 577789875


No 30 
>smart00746 TRASH metallochaperone-like domain.
Probab=21.15  E-value=54  Score=18.45  Aligned_cols=11  Identities=45%  Similarity=0.884  Sum_probs=8.3

Q ss_pred             CCeeeeccccc
Q 026096          161 SFTFCSLGCKI  171 (243)
Q Consensus       161 ~~rFCSL~CKv  171 (243)
                      .+.|||..|..
T Consensus        23 ~~~FCs~~c~~   33 (39)
T smart00746       23 VFYFCSSKCLS   33 (39)
T ss_pred             EEEEeCHHHHH
Confidence            36789988874


No 31 
>PF08002 DUF1697:  Protein of unknown function (DUF1697);  InterPro: IPR012545 This family contains many hypothetical bacterial proteins.; PDB: 2HIY_B.
Probab=21.12  E-value=55  Score=27.07  Aligned_cols=30  Identities=37%  Similarity=0.656  Sum_probs=20.7

Q ss_pred             cceeecchhhhh---hcccceeeEEecCceEEEe
Q 026096          105 HDVIRVSEIQKY---LDITGVQTYIINSARIVFL  135 (243)
Q Consensus       105 hdVVRv~DIqkl---lD~S~IQtYvINsakVVFL  135 (243)
                      ++-|+..|+..+   +-..+|+||+ +|.-|||=
T Consensus        16 ~nki~MaeLr~~l~~~Gf~~V~Tyi-~SGNvvf~   48 (137)
T PF08002_consen   16 KNKIKMAELREALEDLGFTNVRTYI-QSGNVVFE   48 (137)
T ss_dssp             BS---HHHHHHHHHHCT-EEEEEET-TTTEEEEE
T ss_pred             CCcccHHHHHHHHHHcCCCCceEEE-eeCCEEEe
Confidence            456777888775   6788999995 88889987


No 32 
>PRK05707 DNA polymerase III subunit delta'; Validated
Probab=20.97  E-value=1e+02  Score=29.01  Aligned_cols=92  Identities=15%  Similarity=0.273  Sum_probs=49.0

Q ss_pred             CCCcHHHHhccccccccccccc---CCCC----------CcceeccccCCC---cCCccccc-cCCCCc-eeEEEecccc
Q 026096           44 WPPWLRPLLQTSFFVQCKLHAD---AHKS----------ECNMYCLDCMNG---ALCSLCLS-LHRDHR-AIQIRRSSYH  105 (243)
Q Consensus        44 ~P~WL~~LL~~~FF~~C~~H~~---~~kn----------E~N~FCldC~~~---~lC~~Cl~-~H~~Hr-vlQIRRssYh  105 (243)
                      .-|||...++.-+-..--.|.-   +..+          -+-++|.+=.+.   .-|+.|.. ....|+ ++.|..-.-.
T Consensus         4 ~yPWl~~~~~~~~~~~r~~ha~Lf~G~~G~GK~~~A~~~A~~llC~~~~~~~~Cg~C~sC~~~~~g~HPD~~~i~~~~~~   83 (328)
T PRK05707          4 IYPWQQSLWQQLAGRGRHPHAYLLHGPAGIGKRALAERLAAALLCEAPQGGGACGSCKGCQLLRAGSHPDNFVLEPEEAD   83 (328)
T ss_pred             CCCCcHHHHHHHHHCCCcceeeeeECCCCCCHHHHHHHHHHHHcCCCCCCCCCCCCCHHHHHHhcCCCCCEEEEeccCCC
Confidence            4589988887665554444431   1111          113456431111   25777754 444555 4444332223


Q ss_pred             ceeecchhhhhhcccceeeEEecCceEEEee
Q 026096          106 DVIRVSEIQKYLDITGVQTYIINSARIVFLN  136 (243)
Q Consensus       106 dVVRv~DIqkllD~S~IQtYvINsakVVFLn  136 (243)
                      ..|+|++|..+.+--..=++ .++.|||.|.
T Consensus        84 ~~i~id~iR~l~~~~~~~~~-~~~~kv~iI~  113 (328)
T PRK05707         84 KTIKVDQVRELVSFVVQTAQ-LGGRKVVLIE  113 (328)
T ss_pred             CCCCHHHHHHHHHHHhhccc-cCCCeEEEEC
Confidence            56899999887654333222 4578888884


No 33 
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=20.69  E-value=42  Score=32.89  Aligned_cols=19  Identities=37%  Similarity=0.742  Sum_probs=14.2

Q ss_pred             CcceeccccC-----CCcCCcccc
Q 026096           70 ECNMYCLDCM-----NGALCSLCL   88 (243)
Q Consensus        70 E~N~FCldC~-----~~~lC~~Cl   88 (243)
                      =+|.||+||.     ....|+.|-
T Consensus       351 Ck~~FCldCDv~iHesLh~CpgCe  374 (378)
T KOG2807|consen  351 CKNVFCLDCDVFIHESLHNCPGCE  374 (378)
T ss_pred             ccceeeccchHHHHhhhhcCCCcC
Confidence            3689999995     235788886


No 34 
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only]
Probab=20.15  E-value=68  Score=29.79  Aligned_cols=57  Identities=19%  Similarity=0.328  Sum_probs=36.2

Q ss_pred             CCCCCcHHHHhcc-ccc-----c---cccccccCCCCCcceeccccCCCcCCccccc---cCCCCceeEEEe
Q 026096           42 NKWPPWLRPLLQT-SFF-----V---QCKLHADAHKSECNMYCLDCMNGALCSLCLS---LHRDHRAIQIRR  101 (243)
Q Consensus        42 ~~~P~WL~~LL~~-~FF-----~---~C~~H~~~~knE~N~FCldC~~~~lC~~Cl~---~H~~HrvlQIRR  101 (243)
                      ...+.||.+-+.+ -++     .   .|..|.-...   -.-|..|.+.-||..|-.   .|..|..|||.+
T Consensus       131 ~~~~~~~~~~~~~~H~~~~~~~v~CD~C~~~~IvG~---RyKC~~C~dYDLCe~Ce~~~~~h~~H~~lR~~t  199 (278)
T KOG4582|consen  131 ASLVITLNPVVGEMHPNISKLSVPCDNCGKPGIVGA---RYKCTVCPDYDLCERCEAGNEHHAAHAMLRLHT  199 (278)
T ss_pred             hhhhhhcCCCccccCCCcccccccCCCccCCccccc---eeeecCCCccchhHHhhcCCCCCcccceeeccc
Confidence            3456777776552 234     2   4444543221   245999988889999943   456788888877


Done!