Citrus Sinensis ID: 026134


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MGSLQGPVFCPAVRARQGGLYNTVPSTGPVMKARFFRSELWGFKGLTAVKTKVGVFTRQQNARKCKIVQCTFSSSSNGNGSMAENFNENDEDFVNSSVVEAVEVKSGADGFMIKMRDGRHLRCVHNNPQGGHLPDYAPHPAIVLKMEDGTGLLLPIIVLEMPSVLLMAAMRNVQIARPTLYQVVKEMIEKMGYEVRLVRVTKRVHEAYFAQLYLTKVGNETECVSFDLRPSDAINIAVRCKWN
cccccccccccccHccccccCCcccccccccCEEEEEEcccccccccccccccEEEccccccccCEEEEEEccccccccccccccccccccccccccEEEEEEEECcccccEEEEccccEEEEEECccccCECcccccccEEEEEEEccccEEEEEEEcHHHHHHHHHHHcccccccccHHHHHHHHHHHHccEEEEEEEEEEEccEEEEEEEEEEcccccEEEEEccccHHHHHHHHHHccc
****QGPVFCPAVRARQGGLYNTVPSTGPVMKARFFRSELWGFKGLTAVKTKVGVFTRQQNARKCKIVQCTF*******************DFVNSSVVEAVEVKSGADGFMIKMRDGRHLRCVHNNPQGGHLPDYAPHPAIVLKMEDGTGLLLPIIVLEMPSVLLMAAMRNVQIARPTLYQVVKEMIEKMGYEVRLVRVTKRVHEAYFAQLYLTKVGNETECVSFDLRPSDAINIAVRCKW*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLQGPVFCPAVRARQGGLYNTVPSTGPVMKARFFRSELWGFKGLTAVKTKVGVFTRQQNARKCKIVQCTFSSSSNGNGSMAENFNENDEDFVNSSVVEAVEVKSGADGFMIKMRDGRHLRCVHNNPQGGHLPDYAPHPAIVLKMEDGTGLLLPIIVLEMPSVLLMAAMRNVQIARPTLYQVVKEMIEKMGYEVRLVRVTKRVHEAYFAQLYLTKVGNETECVSFDLRPSDAINIAVRCKWN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional nuclease 1 Bifunctional nuclease with both RNase and DNase activites. Involved in basal defense response. Participates in abscisic acid-derived callose deposition following infection by a necrotrophic pathogen.probableQ9FWS6
Bifunctional nuclease 2 Bifunctional nuclease with both RNase and DNase activites. Involved in basal defense response. Participates in abscisic acid-derived callose deposition following infection by a necrotrophic pathogen.probableQ6YZM6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VJL, chain A
Confidence level:very confident
Coverage over the Query: 129-243
View the alignment between query and template
View the model in PyMOL