Citrus Sinensis ID: 026152

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--

MDPAVLDGVIRRLLEVRGKPGKQVQLSESEIRQLCVVSKGIFLRQPNLLEIEAPIKICGDIHGQYSDLLRLFEYALIDEKILCMHGGLSPDLHNLNQIRSLPRPTDVPESGLLCDLLWSDPSNDIKGWEANDRGVSYVFGADRVTEFLQKHDLELICRAHQVVEDGYEFFANRRLITIFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKPKFSFGSTTTVKSGAPPSRMKSFLGAKV

cccccHHHHHHHHHHcccccccCCcccHHHHHHHHHHHHHHcccccCEEEccccccccccccccHHHHHcHHccEEEcccEEEEccccccccccHHHHHcccccccccccccHHHccccccccccccccccccccCEEEcHHHHHHHHHHccccEEEEccccccccccccccccEEEEEccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccc

*DPAVLDGVIRRLLEVRGKPGKQVQLSESEIRQLCVVSKGIFLRQPNLLEIEAPIKICGDIHGQYSDLLRLFEYALIDEKILCMHGGLSPDLHNLNQIRSLPRPTDVPESGLLCDLLWSDPSNDIKGWEANDRGVSYVFGADRVTEFLQKHDLELICRAHQVVEDGYEFFANRRLITIFSAPNYCGEFDNAGAMMSVDETLMCSFQILK*********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein phosphatase PP1-beta catalytic subunit	Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.	probable	P62143
Serine/threonine-protein phosphatase PP1-beta catalytic subunit	Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.	probable	P62142
Serine/threonine-protein phosphatase PP1-beta catalytic subunit	Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.	probable	P62141

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.16	Phosphoprotein phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJM, chain A
Confidence level:very confident
Coverage over the Query: 5-212
View the alignment between query and template
View the model in PyMOL