Citrus Sinensis ID: 026155

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--

MWAQPYRKSDVEAGATPLYPMMSESPQLRWAFIRKIYSIIAIQLLATIAVASVVVSVRPISHFFSSTGAGLALYIVLIITPFIVLCPLYYYYQKHPVNYLLLGVFTIALSFAVGLTCAYTKGEVILESAILTAVVVISLTLYTFWAARRGHDFNFLGPFLFGAVMVLLVFAFIQILFPLGRISVMIYGGLASIIFCGYIIYDTDNLIKRYSYDEYIWAAVALYLDIINLFLSLLTIFRAADN

cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccc

*****************LYPMMSESPQLRWAFIRKIYSIIAIQLLATIAVASVVVSVRPISHFFSSTGAGLALYIVLIITPFIVLCPLYYYYQKHPVNYLLLGVFTIALSFAVGLTCAYTKGEVILESAILTAVVVISLTLYTFWAARRGHDFNFLGPFLFGAVMVLLVFAFIQILFPLGRISVMIYGGLASIIFCGYIIYDTDNLIKRYSYDEYIWAAVALYLDIINLFLSLLTIFRA***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein lifeguard 4	Anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. Can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.	probable	Q9HC24
Protein lifeguard 4	Anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. Can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.	probable	Q9DA39
Uncharacterized protein Cj0236c		probable	Q9PIQ8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted