Citrus Sinensis ID: 026158


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MSSATSSPRTVEEIFKDFKARRSALVRALTYDVDQFYSQCDPEKENLCLYGHPNESWEVTMPADEVPPEIPEPALGINFSRDGMCKKDWLSLVAVHSDCWLVAVAFYFGARLNGNERKRLYSLINDLPTLFEVVTGRISVKDNQPGADGRSKSWNSTKRSIDGQARSKHELLEESLGEVDDAENDETFCGSCGGSYNSAQFWIGCDICERWYHGKCVKITPAKAENIKQYKCPSCSTKKARH
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEECccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHcccccccccHHccccccccccHHEEcccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccEEEccccccccccccccccHHHHcccccCCccccccccccc
***********EEIFKDFKARRSALVRALTYDVDQFYSQCDPEKENLCLYGHPNESWEVTMPADEVPPEIPEPALGINFSRDGMCKKDWLSLVAVHSDCWLVAVAFYFGARLNGNERKRLYSLINDLPTLFEVVTGR********************************************AENDETFCGSCGGSYNSAQFWIGCDICERWYHGKCVKITPAKAENIKQYKCP**S******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSATSSPRTVEEIFKDFKARRSALVRALTYDVDQFYSQCDPEKENLCLYGHPNESWEVTMPADEVPPEIPEPALGINFSRDGMCKKDWLSLVAVHSDCWLVAVAFYFGARLNGNERKRLYSLINDLPTLFEVVTGRISVKDNQPGADGRSKSWNSTKRSIDGQARSKHELLEESLGEVDDAENDETFCGSCGGSYNSAQFWIGCDICERWYHGKCVKITPAKAENIKQYKCPSCSTKKARH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PHD finger protein ALFIN-LIKE 1 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.confidentQ9FFF5
PHD finger protein ALFIN-LIKE 1 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.probableQ75IR6
PHD finger protein ALFIN-LIKE 3 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.probableB8AMA8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WE9, chain A
Confidence level:very confident
Coverage over the Query: 184-242
View the alignment between query and template
View the model in PyMOL