Citrus Sinensis ID: 026200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAHGAK
ccccccEEEEEcccccccHHHHHHHcccccccEEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHccHHHHHHHHHHHHHHHHHHHHcccc
cccccEEEEEEcccccccHHHHHHHHHccccEEEEEEEccccccEEEEEEEccHHHHHHHHHHcccEEcccEEEEEEcccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHcccEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
MYAGGYVAEvvglspnatekDIHEFfshcgdpvhVEIIRsgecggtayVTFSNAYALETAVLLSgativdqpvciirwgeytdepnpwisswgfdensgsttthvgqfvstpgeaVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVdekyhvsdvtksaasftgKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAHGAK
MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAHGAK
MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFtgktavaagtavvNSRYFAKGALWVSGVLERaakaaadlgahgak
****GYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAA************
***GGYV*EVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRW*****************************************************************LDE*YGLSASAAAKVA*LS****L*****ASM***************TKSAASFTGKTAVA*GTAVVNSRYFAKGALWVSGVLERAAK***********
MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAHGAK
****GYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGEY********************************EAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLG*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAHGAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
P87216257 Protein vip1 OS=Schizosac yes no 0.603 0.568 0.291 1e-09
>sp|P87216|VIPI_SCHPO Protein vip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vip1 PE=1 SV=1 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 87/185 (47%), Gaps = 39/185 (21%)

Query: 10  VVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIV 69
           V  +SP  TEK I +FFS CG   ++   +SGE   TA + F    A +TA+LL  A + 
Sbjct: 7   VTNISPEVTEKQISDFFSFCGKVSNISTEKSGET-QTAKIQFERPSATKTALLLQDALLG 65

Query: 70  DQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKT---- 125
              + I      T E          D  + STT   G      G+     +D  ++    
Sbjct: 66  QNKIQI------TSE----------DGGAASTTDQGG----AGGDQAARQEDKPRSAIIS 105

Query: 126 -MIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVDEK 184
            ++++GY LS   L K+  LD+SYG+S          S   G+   + +++  ++SV+E+
Sbjct: 106 ELLSRGYHLSDVTLEKSIQLDQSYGVS----------SKFKGI---LESALSGVRSVNER 152

Query: 185 YHVSD 189
           YHV++
Sbjct: 153 YHVTE 157





Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
296082886235 unnamed protein product [Vitis vinifera] 0.962 0.991 0.679 6e-82
224140969248 predicted protein [Populus trichocarpa] 0.979 0.955 0.649 4e-79
147791771262 hypothetical protein VITISV_036652 [Viti 0.962 0.889 0.618 5e-79
225452761262 PREDICTED: protein vip1-like isoform 2 [ 0.962 0.889 0.618 9e-79
224140971231 predicted protein [Populus trichocarpa] 0.933 0.978 0.649 3e-78
388511771245 unknown [Lotus japonicus] 0.987 0.975 0.612 2e-76
255552904240 nucleic acid binding protein, putative [ 0.921 0.929 0.649 6e-76
48209876244 hypothetical protein [Solanum demissum] 0.991 0.983 0.626 3e-75
418731492245 RNA recognition motif containing protein 0.991 0.979 0.628 9e-75
356500407244 PREDICTED: uncharacterized protein LOC10 0.987 0.979 0.591 3e-74
>gi|296082886|emb|CBI22187.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  309 bits (792), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 165/243 (67%), Positives = 187/243 (76%), Gaps = 10/243 (4%)

Query: 1   MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETA 60
           MY G Y AEV  LSP ATEKD+++FF HCG   H+EIIRSGEC  TAYVTF + YALETA
Sbjct: 1   MYPGAYTAEVTCLSPKATEKDVYDFFIHCGMIEHLEIIRSGECARTAYVTFRDFYALETA 60

Query: 61  VLLSGATIVDQPVCIIRWGEYTDEPNPWI-SSWGFDENSGSTTTHVGQFVSTPGEAVTVA 119
           VLLSGATIVDQ VCI  WG Y DE +PW  SSW ++ NS +TT         P EAVTVA
Sbjct: 61  VLLSGATIVDQRVCISGWGIYADESDPWSNSSWNYEINSMATT---------PREAVTVA 111

Query: 120 QDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIK 179
           Q+ V TMIAKGYVL KDAL+KAKA DE++G+SA+AAAK+AELS RIGLTDKI A +EA++
Sbjct: 112 QEVVTTMIAKGYVLGKDALIKAKAFDEAHGVSAAAAAKIAELSKRIGLTDKIYAGVEAVR 171

Query: 180 SVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAH 239
           SVDEKYH+ + TKSAA  TGKT VAA  A VNS YFAKGALWVSG+L RAA AAADLG  
Sbjct: 172 SVDEKYHLLEFTKSAAVVTGKTTVAAANAFVNSSYFAKGALWVSGILTRAANAAADLGNK 231

Query: 240 GAK 242
           G K
Sbjct: 232 GNK 234




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224140969|ref|XP_002323849.1| predicted protein [Populus trichocarpa] gi|222866851|gb|EEF03982.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147791771|emb|CAN61841.1| hypothetical protein VITISV_036652 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225452761|ref|XP_002283067.1| PREDICTED: protein vip1-like isoform 2 [Vitis vinifera] gi|225452763|ref|XP_002283061.1| PREDICTED: protein vip1-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140971|ref|XP_002323850.1| predicted protein [Populus trichocarpa] gi|222866852|gb|EEF03983.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388511771|gb|AFK43947.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255552904|ref|XP_002517495.1| nucleic acid binding protein, putative [Ricinus communis] gi|223543506|gb|EEF45037.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|48209876|gb|AAT40482.1| hypothetical protein [Solanum demissum] Back     alignment and taxonomy information
>gi|418731492|gb|AFX67041.1| RNA recognition motif containing protein [Solanum tuberosum] Back     alignment and taxonomy information
>gi|356500407|ref|XP_003519023.1| PREDICTED: uncharacterized protein LOC100805907 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
TAIR|locus:2012567244 AT1G14340 [Arabidopsis thalian 0.917 0.909 0.513 7e-54
TAIR|locus:2102067249 AT3G01210 [Arabidopsis thalian 0.913 0.887 0.524 3.8e-53
TAIR|locus:2129401313 AT4G17720 [Arabidopsis thalian 0.871 0.674 0.383 1.8e-32
TAIR|locus:2145806267 AT5G32450 [Arabidopsis thalian 0.896 0.812 0.406 2.3e-32
TAIR|locus:2172947295 AT5G46870 [Arabidopsis thalian 0.884 0.725 0.382 4.7e-32
TAIR|locus:2200211279 AT1G67950 [Arabidopsis thalian 0.855 0.741 0.32 3.3e-24
TAIR|locus:2148970260 BPA1 "binding partner of acd11 0.690 0.642 0.358 1.6e-22
DICTYBASE|DDB_G0291155311 DDB_G0291155 "RNA-binding regi 0.776 0.604 0.285 3.6e-13
POMBASE|SPAC10F6.06257 vip1 "RNA-binding protein Vip1 0.677 0.638 0.288 4.6e-10
ASPGD|ASPL0000008076270 AN6004 [Emericella nidulans (t 0.702 0.629 0.298 2e-09
TAIR|locus:2012567 AT1G14340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 557 (201.1 bits), Expect = 7.0e-54, P = 7.0e-54
 Identities = 116/226 (51%), Positives = 150/226 (66%)

Query:     5 GYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLS 64
             GY  EV GLSP+ T  D+ +FFS  G    ++I+RSGE   TAYV F ++Y+ ETAVLL+
Sbjct:     6 GYGVEVTGLSPSVTHNDLIDFFSFSGTIQDIDIVRSGEQACTAYVMFKDSYSQETAVLLT 65

Query:    65 GATIVDQPVCIIRWGEYTDEPNPW-ISSWGFDENSGSTTTHVGQFVS-TPGEAVTVAQDA 122
             GATI+DQ VCI RWG++ +E + W  +S GF++ S S   H  Q      GEAVT AQ+ 
Sbjct:    66 GATILDQRVCITRWGQHHEEFDFWNATSRGFEDESDSQ--HYAQRSEFNAGEAVTKAQEV 123

Query:   123 VKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKSVD 182
             VK M+A G+VL KDAL KAKA DES+G+SA+A A+V++L  RIGLTDKI   +EA++  D
Sbjct:   124 VKIMLATGFVLGKDALSKAKAFDESHGVSAAAVARVSQLEQRIGLTDKIFTGLEAVRMTD 183

Query:   183 EKYHVSDVTKSAASFXXXXXXXXXXXXXNSRYFAKGALWVSGVLER 228
             ++YHVSD  KSA                NS YF+ GALW+SG LER
Sbjct:   184 QRYHVSDTAKSAVFATGRTAAAAATSVVNSSYFSSGALWLSGALER 229




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0006301 "postreplication repair" evidence=RCA
TAIR|locus:2102067 AT3G01210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129401 AT4G17720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145806 AT5G32450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172947 AT5G46870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200211 AT1G67950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148970 BPA1 "binding partner of acd11 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291155 DDB_G0291155 "RNA-binding region RNP-1 domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC10F6.06 vip1 "RNA-binding protein Vip1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008076 AN6004 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
PLN03121243 PLN03121, PLN03121, nucleic acid binding protein; 1e-132
PLN03120260 PLN03120, PLN03120, nucleic acid binding protein; 3e-69
cd1226969 cd12269, RRM_Vip1_like, RNA recognition motif in a 9e-28
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-10
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 7e-10
smart0036073 smart00360, RRM, RNA recognition motif 1e-09
cd1226868 cd12268, RRM_Vip1, RNA recognition motif in fissio 6e-09
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 3e-07
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 5e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-07
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 7e-07
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-06
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 7e-06
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 7e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-05
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-05
cd1222884 cd12228, RRM_ENOX, RNA recognition motif (RRM) in 2e-05
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 2e-05
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 3e-05
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-04
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 1e-04
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 2e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 6e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 6e-04
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 6e-04
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 9e-04
cd1225976 cd12259, RRM_SRSF11_SREK1, RNA recognition motif i 0.002
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 0.003
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.003
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 0.003
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.004
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 0.004
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 0.004
>gnl|CDD|215589 PLN03121, PLN03121, nucleic acid binding protein; Provisional Back     alignment and domain information
 Score =  373 bits (960), Expect = e-132
 Identities = 171/242 (70%), Positives = 191/242 (78%)

Query: 1   MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETA 60
           MY GGY AEV  LSP ATEKD+++FFSHCG   HVEIIRSGE   TAYVTF +AYALETA
Sbjct: 1   MYPGGYTAEVTNLSPKATEKDVYDFFSHCGAIEHVEIIRSGEYACTAYVTFKDAYALETA 60

Query: 61  VLLSGATIVDQPVCIIRWGEYTDEPNPWISSWGFDENSGSTTTHVGQFVSTPGEAVTVAQ 120
           VLLSGATIVDQ VCI RWG+Y DE + W       E+  +      QF STPGEAVTVAQ
Sbjct: 61  VLLSGATIVDQRVCITRWGQYEDEFDFWNRPSWDTEDISTHNYETNQFASTPGEAVTVAQ 120

Query: 121 DAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKS 180
           + VKTM+AKGYVL KDAL KAKA DES+ +SA+AAAKVAELS RIGLTDKI A MEA++S
Sbjct: 121 EVVKTMLAKGYVLGKDALSKAKAFDESHQVSATAAAKVAELSKRIGLTDKIFAGMEAVRS 180

Query: 181 VDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAHG 240
           VDEKYHVS+ TKSAA+ TG+TA AA  AVVNS YF+KGALWVS  L RAAKAAADLGAHG
Sbjct: 181 VDEKYHVSEFTKSAATATGRTAAAAANAVVNSSYFSKGALWVSDALTRAAKAAADLGAHG 240

Query: 241 AK 242
           + 
Sbjct: 241 SN 242


Length = 243

>gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240715 cd12269, RRM_Vip1_like, RNA recognition motif in a group of uncharacterized plant proteins similar to fission yeast Vip1 Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240714 cd12268, RRM_Vip1, RNA recognition motif in fission yeast protein Vip1 and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or ENOX) proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240705 cd12259, RRM_SRSF11_SREK1, RNA recognition motif in serine/arginine-rich splicing factor 11 (SRSF11), splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
PLN03121243 nucleic acid binding protein; Provisional 100.0
PLN03120260 nucleic acid binding protein; Provisional 100.0
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.56
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.55
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.44
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.41
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.4
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.4
smart0036272 RRM_2 RNA recognition motif. 99.35
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.34
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.32
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.31
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.28
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.27
PLN03213 759 repressor of silencing 3; Provisional 99.24
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.24
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.22
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.21
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.21
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.21
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.19
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.19
smart0036071 RRM RNA recognition motif. 99.18
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.17
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.17
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.14
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.14
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.13
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.13
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.13
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.09
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.09
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.07
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.05
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.03
KOG0122270 consensus Translation initiation factor 3, subunit 99.03
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.99
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 98.94
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 98.92
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.91
KOG4207256 consensus Predicted splicing factor, SR protein su 98.89
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.83
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.82
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.78
smart0036170 RRM_1 RNA recognition motif. 98.78
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.76
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.72
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.71
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 98.71
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 98.7
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.7
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.69
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.68
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 98.67
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 98.63
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.59
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.58
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.58
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.56
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.53
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 98.47
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.44
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.44
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.44
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.39
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.39
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.36
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.36
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.35
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.34
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.22
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.22
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 98.21
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.18
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.18
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.16
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.16
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.15
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.11
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 97.98
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 97.91
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.86
KOG4660 549 consensus Protein Mei2, essential for commitment t 97.85
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 97.83
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.79
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 97.71
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.68
KOG0151 877 consensus Predicted splicing regulator, contains R 97.66
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.6
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.52
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.5
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 97.47
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.38
KOG3152278 consensus TBP-binding protein, activator of basal 97.07
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.04
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.02
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 96.96
KOG4210285 consensus Nuclear localization sequence binding pr 96.95
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 96.88
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.88
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 96.81
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 96.59
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 96.45
KOG0226290 consensus RNA-binding proteins [General function p 96.18
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.11
PLN03120260 nucleic acid binding protein; Provisional 95.96
KOG1855484 consensus Predicted RNA-binding protein [General f 95.93
KOG1548382 consensus Transcription elongation factor TAT-SF1 95.65
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 95.52
KOG0129520 consensus Predicted RNA-binding protein (RRM super 95.43
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 95.41
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 95.28
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 94.7
KOG1996378 consensus mRNA splicing factor [RNA processing and 94.48
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 94.32
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 94.09
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 94.02
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 93.65
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 93.59
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 93.3
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 93.07
KOG2314 698 consensus Translation initiation factor 3, subunit 92.88
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 92.77
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 92.68
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.55
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 91.68
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 91.45
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 91.31
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 91.08
PF15023166 DUF4523: Protein of unknown function (DUF4523) 90.56
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 89.27
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 88.55
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 88.32
PLN03121243 nucleic acid binding protein; Provisional 88.1
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 87.82
KOG2068327 consensus MOT2 transcription factor [Transcription 87.22
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 86.23
KOG2135526 consensus Proteins containing the RNA recognition 85.08
PF1551362 DUF4651: Domain of unknown function (DUF4651) 84.24
KOG2591 684 consensus c-Mpl binding protein, contains La domai 82.64
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 82.63
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-82  Score=559.75  Aligned_cols=241  Identities=71%  Similarity=1.020  Sum_probs=227.4

Q ss_pred             CCCCCcEEEEeCCCCCCCHHHHHHHhccCCCceEEEEeecCCcCceEEEEecCHHHHHHHHhcCCCeecCeeEEEEecCC
Q 026200            1 MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRWGE   80 (242)
Q Consensus         1 M~~~~~tV~VsNLs~~~TE~dLrefFs~~G~I~~V~l~~~~~~~~~AfV~F~~~~aA~tAl~Lng~~l~g~~I~V~~a~~   80 (242)
                      |+++++||||+||++.+||++|++||++||+|.+|+|++++++.++|||+|++++++++|++|||.+|.|++|.|++|++
T Consensus         1 m~~~g~TV~V~NLS~~tTE~dLrefFS~~G~I~~V~I~~D~et~gfAfVtF~d~~aaetAllLnGa~l~d~~I~It~~~~   80 (243)
T PLN03121          1 MYPGGYTAEVTNLSPKATEKDVYDFFSHCGAIEHVEIIRSGEYACTAYVTFKDAYALETAVLLSGATIVDQRVCITRWGQ   80 (243)
T ss_pred             CCCCceEEEEecCCCCCCHHHHHHHHHhcCCeEEEEEecCCCcceEEEEEECCHHHHHHHHhcCCCeeCCceEEEEeCcc
Confidence            89999999999999999999999999999999999999998888999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCC-CCCCCCCCCCCccccCccccCcchhhhhHHHHHHHHhhccceecHHHHHHHHHhhhhcCCcHHHHHHHH
Q 026200           81 YTDEPNPWIS-SWGFDENSGSTTTHVGQFVSTPGEAVTVAQDAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVA  159 (242)
Q Consensus        81 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~p~~a~~~a~~iva~~LA~Gyvl~~~ai~kA~~~Dekh~~ss~~~~~v~  159 (242)
                      |.+++++|+. ++..++ ..+...+.+.+..+|++++++||+||++||||||+||+|+++|||+|||+||||++++++|.
T Consensus        81 y~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~p~~a~~~aq~Vv~tmLAkGyvLgkda~~KAkafDE~h~lss~a~a~v~  159 (243)
T PLN03121         81 YEDEFDFWNRPSWDTED-ISTHNYETNQFASTPGEAVTVAQEVVKTMLAKGYVLGKDALSKAKAFDESHQVSATAAAKVA  159 (243)
T ss_pred             cccCcccccCccccccc-cccccccccccCCCchhhHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHhcCccHhhhhhhh
Confidence            9999998876 223333 33444555667789999999999999999999999999999999999999999999999999


Q ss_pred             hhhhccccchhhhhHHHHHHHhhhhhchhHHhhHhhhhhhhhhhhcccccccchhhhhhhhhHhhHHHHHHHHHHhhccc
Q 026200          160 ELSNRIGLTDKINASMEAIKSVDEKYHVSDVTKSAASFTGKTAVAAGTAVVNSRYFAKGALWVSGVLERAAKAAADLGAH  239 (242)
Q Consensus       160 ~~d~k~g~t~k~~~g~~~~~~vD~k~~vs~~t~sa~~~~~~~~~~~~~~~~~~~y~~~ga~w~~~a~~~~a~~~~~~~~~  239 (242)
                      +||+||||||||++|+++||+|||||||||+||+|+.+|||++++||++||+||||++||+||||||+||||||.|+|++
T Consensus       160 ~~d~~iglt~k~~~g~~~vk~vDeky~vs~~tksA~~aa~~~~~~a~sai~~~~Y~~~Ga~w~sga~~~~akaa~~~g~~  239 (243)
T PLN03121        160 ELSKRIGLTDKIFAGMEAVRSVDEKYHVSEFTKSAATATGRTAAAAANAVVNSSYFSKGALWVSDALTRAAKAAADLGAH  239 (243)
T ss_pred             hhhhhccchhhhhhhHHHHHhhhhhhhhHHHHHHHHHHHHHHHHHhhhhhhhcchhhcchHHHHHHHHHHHHHHHHhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCC
Q 026200          240 GAK  242 (242)
Q Consensus       240 ~~~  242 (242)
                      |++
T Consensus       240 ~~~  242 (243)
T PLN03121        240 GSN  242 (243)
T ss_pred             ccC
Confidence            974



>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF15513 DUF4651: Domain of unknown function (DUF4651) Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-10
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-09
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-09
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 6e-09
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 9e-09
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-08
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-08
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-08
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-08
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-08
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 6e-08
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 6e-08
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 7e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-07
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-07
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-07
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-07
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-07
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 4e-07
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-07
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 5e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 6e-07
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-07
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 9e-07
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-06
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-06
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-06
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-06
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 4e-06
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-06
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 8e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-06
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-06
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-05
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-06
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-04
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-06
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 7e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-05
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 6e-06
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 7e-06
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 7e-06
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 9e-06
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-05
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-05
2div_A99 TRNA selenocysteine associated protein; structural 1e-05
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-05
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-05
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-05
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-05
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-05
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-05
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-05
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-05
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-05
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 3e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-05
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-05
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-05
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-05
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 5e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 5e-05
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-05
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 5e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-04
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 7e-05
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 8e-05
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 9e-05
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-04
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-04
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-04
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-04
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-04
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-04
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-04
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-04
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-04
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-04
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-04
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-04
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-04
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-04
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-04
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-04
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-04
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-04
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-04
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-04
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-04
1x4e_A85 RNA binding motif, single-stranded interacting pro 5e-04
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-04
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 6e-04
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 7e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 7e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 7e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 9e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-04
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
 Score = 54.2 bits (131), Expect = 7e-10
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 10 VVGLSPNATEKDIHEFFSHCGDPVHVEIIR---SGECGGTAYVTFSNAYALETAVLLSGA 66
           + L+     +D+ +FFS  G    V II    S    G AYV F    ++  A+ L+G 
Sbjct: 30 CMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIGLTGQ 89

Query: 67 TIVDQPV 73
           ++  P+
Sbjct: 90 RLLGVPI 96


>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.73
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.69
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.68
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.68
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.68
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.67
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.67
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.67
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.67
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.67
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.67
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.66
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.66
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.66
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.66
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.66
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.66
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.66
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.66
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.66
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.65
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.65
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.65
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.65
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.65
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.65
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.65
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.65
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.64
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.64
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.64
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.63
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.63
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.63
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.63
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.63
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.63
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.63
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.63
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.63
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.62
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.62
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.62
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.62
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.62
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.62
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.62
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.62
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.62
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.62
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.62
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.61
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.61
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.61
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.61
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.61
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.61
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.61
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.61
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.61
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.61
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.61
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.61
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.6
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.6
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.6
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.6
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.6
2div_A99 TRNA selenocysteine associated protein; structural 99.6
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.6
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.6
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.6
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.6
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.6
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.6
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.6
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.59
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.59
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.59
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.59
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.59
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.59
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.59
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.59
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.59
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.59
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.59
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.59
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.59
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.58
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.58
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.58
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.58
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.58
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.58
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.57
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.57
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.57
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.57
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.57
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.57
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.57
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.57
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.57
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.57
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.57
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.57
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.57
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.57
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.57
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.57
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.56
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.56
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.56
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.56
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.56
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.56
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.55
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.55
2dis_A109 Unnamed protein product; structural genomics, RRM 99.55
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.55
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.55
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.55
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.54
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.54
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.54
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.54
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.54
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.54
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.53
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.53
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.53
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.53
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.53
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.53
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.53
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.53
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.52
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.52
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.52
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.51
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.51
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.51
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.5
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.5
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.49
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.49
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.49
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.49
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.49
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.49
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.49
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.48
1x5p_A97 Negative elongation factor E; structure genomics, 99.48
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.48
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.48
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.21
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.47
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.47
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.47
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.46
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.45
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.44
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.44
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.44
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.44
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.43
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.43
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.42
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.42
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.42
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.41
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.41
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.41
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.41
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.41
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.4
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.4
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.38
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.38
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.37
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.37
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.37
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.37
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.37
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.33
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.33
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.33
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.33
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.33
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.33
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.32
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.31
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.3
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.27
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.24
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.18
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.14
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.12
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.11
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.05
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.04
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.97
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.96
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.95
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.74
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.27
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.24
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.11
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.79
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.47
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 97.37
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.85
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.92
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.82
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.17
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.36
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 81.03
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.73  E-value=1.8e-17  Score=126.22  Aligned_cols=78  Identities=23%  Similarity=0.317  Sum_probs=70.2

Q ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHhccCCCceEEEEeecCC---cCceEEEEecCHHHHHHHH-hcCCCeecCeeEEEEe
Q 026200            2 YAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGE---CGGTAYVTFSNAYALETAV-LLSGATIVDQPVCIIR   77 (242)
Q Consensus         2 ~~~~~tV~VsNLs~~~TE~dLrefFs~~G~I~~V~l~~~~~---~~~~AfV~F~~~~aA~tAl-~Lng~~l~g~~I~V~~   77 (242)
                      +..+++|||+|||+++||++|+++|+.||+|.+|++.++..   ..++|||+|.++++|+.|+ .|||..|+|++|.|..
T Consensus        16 ~~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~   95 (99)
T 4fxv_A           16 YFQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSY   95 (99)
T ss_dssp             CCCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEE
Confidence            44568999999999999999999999999999999998754   2369999999999999995 7999999999999987


Q ss_pred             cC
Q 026200           78 WG   79 (242)
Q Consensus        78 a~   79 (242)
                      +.
T Consensus        96 Ak   97 (99)
T 4fxv_A           96 AR   97 (99)
T ss_dssp             CC
T ss_pred             ee
Confidence            64



>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-08
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 9e-08
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-07
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-07
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-06
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-06
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-06
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-06
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 1e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-05
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 6e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 6e-05
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 8e-05
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 8e-05
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-04
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-04
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 5e-04
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 6e-04
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 7e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 8e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 8e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 8e-04
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 0.001
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 0.001
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.001
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.001
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 0.002
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 0.003
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.004
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 46.9 bits (111), Expect = 6e-08
 Identities = 14/70 (20%), Positives = 27/70 (38%), Gaps = 6/70 (8%)

Query: 10 VVGLSPNATEKDIHEFFSHCGDPVHVEIIR----SGECGGTAYVTFSNAYALETAV--LL 63
          V  +   A +++I E FS  G+   V + +    +G   G  +V F      + A   L 
Sbjct: 13 VRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAFNALC 72

Query: 64 SGATIVDQPV 73
              +  + +
Sbjct: 73 HSTHLYGRRL 82


>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.74
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.73
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.72
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.71
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.71
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.7
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.7
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.7
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.7
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.7
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.7
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.69
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.69
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.69
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.69
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.68
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.68
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.68
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.68
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.68
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.68
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.67
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.67
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.67
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.67
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.66
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.66
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.66
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.66
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.65
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.64
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.64
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.64
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.64
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.64
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.64
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.64
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.64
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.63
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.63
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.63
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.62
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.62
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.62
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.62
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.61
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.61
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.6
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.59
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.59
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.59
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.59
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.59
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.59
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.59
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.58
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.57
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.56
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.55
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.55
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.55
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.54
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.53
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.52
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.51
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.5
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.5
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.5
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.5
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.48
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.47
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.45
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.39
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.37
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.33
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.26
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.16
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.13
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.9
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.43
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.02
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.83
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 87.21
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: U4/U6 snRNA-associated-splicing factor PRP24
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.78  E-value=4.4e-19  Score=127.67  Aligned_cols=73  Identities=16%  Similarity=0.251  Sum_probs=67.9

Q ss_pred             cEEEEeCCCCCCCHHHHHHHhccCCCceEEEEeecCC-cCceEEEEecCHHHHHHHHhcCCCeecCeeEEEEec
Q 026200            6 YVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGE-CGGTAYVTFSNAYALETAVLLSGATIVDQPVCIIRW   78 (242)
Q Consensus         6 ~tV~VsNLs~~~TE~dLrefFs~~G~I~~V~l~~~~~-~~~~AfV~F~~~~aA~tAl~Lng~~l~g~~I~V~~a   78 (242)
                      +||||+|||+++++++|++||+.||+|.+|+|.++++ ..++|||+|.++++|+.|+.+||..|+|++|.|...
T Consensus         1 Ttv~V~nlp~~~t~~~l~~~F~~~G~I~~v~~~~~~~~~~~~afV~F~~~~~a~~Al~~~~~~i~g~~i~V~~~   74 (75)
T d2ghpa2           1 TTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHL   74 (75)
T ss_dssp             CEEEEEEECTTCCHHHHHHHHGGGSCEEEEEEEECTTSSSEEEEEEESSHHHHHHHHTTTTCEETTEECEEEEC
T ss_pred             CEEEEECCCCCCCHHHHHHHHhcCCceEEEEEEeeccccceEEEEEEcchHHhHHHHHhcCcEECCEEEEEEEC
Confidence            4899999999999999999999999999999997754 346999999999999999999999999999999865



>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure