Citrus Sinensis ID: 026221

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MAKSSGINPELLLSQKLPEKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGSVLNHNYKTELVNYYFHY
ccccccccHHHHcccccccCEEECcHHHHHHHHHHccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccEEEEEEcccccccEEEEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEECccccccEEEEEccccccccccHHHHHHccccEEEEECcccccccccc
*****GI*PELLLSQKLPEKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGF********************KIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGSVLNHNYKTELVNYYFHY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSSGINPELLLSQKLPEKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGSVLNHNYKTELVNYYFHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Enoyl-CoA hydratase 2, peroxisomal Bidirectional monofunctional enoyl-CoA hydratase 2 involved in the degradation of even cis-unsaturated fatty acids. Devoid of 3-hydroxyacyl-CoA dehydrogenase activity.probableQ8VYI3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S9C, chain A
Confidence level:very confident
Coverage over the Query: 12-77,93-154,166-235
View the alignment between query and template
View the model in PyMOL