Query         026233
Match_columns 241
No_of_seqs    32 out of 34
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 05:22:53 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026233.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026233hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG4907 Predicted membrane pro  80.7     1.1 2.4E-05   45.3   2.3    6   94-99    538-543 (595)
  2 PRK10930 FtsH protease regulat  75.8      10 0.00023   36.8   7.3   13   87-99     39-51  (419)
  3 PLN03138 Protein TOC75; Provis  75.0     2.5 5.4E-05   44.5   3.0   11  134-144   105-115 (796)
  4 PF07655 Secretin_N_2:  Secreti  62.0      13 0.00028   28.9   3.9   16  133-148    69-84  (98)
  5 PRK10590 ATP-dependent RNA hel  59.9     9.4  0.0002   36.1   3.3    9   74-82    358-366 (456)
  6 PF06679 DUF1180:  Protein of u  57.5      29 0.00063   30.2   5.6   23  134-156    92-114 (163)
  7 KOG3973 Uncharacterized conser  51.5      12 0.00026   37.1   2.6    6   25-30    311-316 (465)
  8 PHA00370 III attachment protei  47.6      21 0.00046   33.9   3.5    7   73-79     74-80  (297)
  9 PF09451 ATG27:  Autophagy-rela  46.8      53  0.0012   29.6   5.8   14  142-156   207-220 (268)
 10 KOG0921 Dosage compensation co  46.0      15 0.00033   40.3   2.5   14   52-65   1183-1196(1282)
 11 COG4371 Predicted membrane pro  45.1      36 0.00077   32.7   4.5    7  213-219   191-197 (334)
 12 PHA00370 III attachment protei  41.9      27 0.00059   33.2   3.3    7   41-47     50-56  (297)
 13 PLN03134 glycine-rich RNA-bind  39.1     5.5 0.00012   32.7  -1.5    8   70-77     87-94  (144)
 14 PTZ00146 fibrillarin; Provisio  37.0      32  0.0007   32.3   3.0   16  221-236   215-230 (293)
 15 KOG3915 Transcription regulato  35.9      36 0.00078   35.0   3.3   27  154-180   189-218 (641)
 16 PF12301 CD99L2:  CD99 antigen   35.5      66  0.0014   28.1   4.4   11  144-154   126-136 (169)
 17 PF09972 DUF2207:  Predicted me  34.9 1.7E+02  0.0036   27.0   7.1   27  172-198   449-475 (511)
 18 KOG3449 60S acidic ribosomal p  34.1 1.1E+02  0.0024   25.6   5.3   33   75-108    38-70  (112)
 19 KOG3074 Transcriptional regula  34.1      29 0.00062   32.6   2.1   12  223-234   155-166 (263)
 20 PF12300 DUF3628:  Protein of u  34.0      71  0.0015   28.6   4.4   40   88-127    37-80  (180)
 21 TIGR02877 spore_yhbH sporulati  33.1      49  0.0011   32.3   3.6   18  132-149   112-129 (371)
 22 PF12575 DUF3753:  Protein of u  32.7      39 0.00084   26.3   2.3   20  124-143    12-31  (72)
 23 PF02957 TT_ORF2:  TT viral ORF  32.6      68  0.0015   25.5   3.8   14  134-147   105-118 (122)
 24 PF04801 Sin_N:  Sin-like prote  31.4      26 0.00057   33.2   1.5   24  160-185   332-355 (421)
 25 KOG3915 Transcription regulato  31.4      39 0.00084   34.8   2.6   21  164-184   221-241 (641)
 26 PRK05865 hypothetical protein;  29.9 2.1E+02  0.0045   30.7   7.7   25  213-237   590-614 (854)
 27 PRK07772 single-stranded DNA-b  28.8      55  0.0012   28.8   2.9   11   52-62     72-82  (186)
 28 PF14584 DUF4446:  Protein of u  26.9   3E+02  0.0065   23.5   6.9   57  142-199     5-68  (151)
 29 PRK09174 F0F1 ATP synthase sub  26.6      94   0.002   27.3   4.0   16  141-156    55-70  (204)
 30 PF03954 Lectin_N:  Hepatic lec  26.5 1.4E+02   0.003   25.8   4.8   45  142-201    35-79  (138)
 31 PF07125 DUF1378:  Protein of u  25.6 1.3E+02  0.0029   22.7   4.0    8  169-176    16-23  (59)
 32 PF09323 DUF1980:  Domain of un  24.9      94   0.002   26.3   3.5   33  142-175     5-37  (182)
 33 COG1314 SecG Preprotein transl  24.2 1.8E+02   0.004   22.8   4.8   22  136-157    47-68  (86)
 34 PRK06241 phosphoenolpyruvate s  23.9      55  0.0012   34.5   2.3   23  213-235   592-614 (871)
 35 TIGR01659 sex-lethal sex-letha  23.5      76  0.0017   29.9   3.0    6   76-81    248-253 (346)
 36 PF05611 DUF780:  Caenorhabditi  22.9      78  0.0017   24.6   2.4    7  102-108    32-38  (71)
 37 PF13703 PepSY_TM_2:  PepSY-ass  22.0 1.7E+02  0.0038   21.8   4.1   50  140-193    16-67  (88)
 38 PRK05325 hypothetical protein;  21.6      92   0.002   30.7   3.2   18  132-149   100-117 (401)
 39 TIGR02916 PEP_his_kin putative  21.4 3.6E+02  0.0078   26.8   7.2   61  134-199   257-317 (679)
 40 PF14992 TMCO5:  TMCO5 family    21.2 1.3E+02  0.0028   28.5   4.0   32  134-165   212-250 (280)
 41 PF01102 Glycophorin_A:  Glycop  21.2      86  0.0019   26.1   2.5   19  139-157    70-88  (122)
 42 PF09441 Abp2:  ARS binding pro  20.9      83  0.0018   28.2   2.5   35  179-216   100-136 (175)
 43 TIGR01431 adm_rel adenosine de  20.9 2.1E+02  0.0045   28.4   5.5   63  128-196   411-478 (479)
 44 PRK11448 hsdR type I restricti  20.7      99  0.0021   33.9   3.5   47  159-210  1019-1069(1123)
 45 PTZ00009 heat shock 70 kDa pro  20.6 1.5E+02  0.0033   30.0   4.6    7   75-81    578-584 (653)
 46 PRK08296 hypothetical protein;  20.5 2.3E+02  0.0049   29.3   5.8   22  213-234   298-319 (603)
 47 PF07234 DUF1426:  Protein of u  20.0 1.2E+02  0.0026   25.4   3.1   30  146-175    22-51  (117)

No 1  
>COG4907 Predicted membrane protein [Function unknown]
Probab=80.73  E-value=1.1  Score=45.26  Aligned_cols=6  Identities=17%  Similarity=0.230  Sum_probs=3.0

Q ss_pred             HHHHHh
Q 026233           94 RQQIQK   99 (241)
Q Consensus        94 ~~qI~K   99 (241)
                      +++|+-
T Consensus       538 ~e~ikd  543 (595)
T COG4907         538 MEIIKD  543 (595)
T ss_pred             HhHhcc
Confidence            455554


No 2  
>PRK10930 FtsH protease regulator HflK; Provisional
Probab=75.83  E-value=10  Score=36.85  Aligned_cols=13  Identities=23%  Similarity=0.593  Sum_probs=7.7

Q ss_pred             CCHHHHHHHHHHh
Q 026233           87 QSIEDVLRQQIQK   99 (241)
Q Consensus        87 ~SieD~L~~qI~K   99 (241)
                      -.++|+|++--+|
T Consensus        39 pdl~~~~~~~~~~   51 (419)
T PRK10930         39 PDLDDIFRKLSKK   51 (419)
T ss_pred             CCHHHHHHHHHHH
Confidence            3477777764444


No 3  
>PLN03138 Protein TOC75; Provisional
Probab=75.03  E-value=2.5  Score=44.47  Aligned_cols=11  Identities=0%  Similarity=-0.375  Sum_probs=6.7

Q ss_pred             cchHHHHHHHH
Q 026233          134 GIIDETVQVVL  144 (241)
Q Consensus       134 ~~~dE~~QvvL  144 (241)
                      +||-+..+..-
T Consensus       105 ~~~~~~~~~~~  115 (796)
T PLN03138        105 RFWLRLFAPAD  115 (796)
T ss_pred             chhhhhcChhh
Confidence            57877655443


No 4  
>PF07655 Secretin_N_2:  Secretin N-terminal domain;  InterPro: IPR011514 This is a short domain found in bacterial type II/III secretory system proteins. The architecture of these proteins suggests that this family may be functionally analogous to IPR005644 from INTERPRO.; GO: 0009297 pilus assembly, 0019867 outer membrane
Probab=61.98  E-value=13  Score=28.91  Aligned_cols=16  Identities=19%  Similarity=0.356  Sum_probs=12.8

Q ss_pred             ccchHHHHHHHHHHHH
Q 026233          133 SGIIDETVQVVLATIG  148 (241)
Q Consensus       133 ~~~~dE~~QvvLAtlg  148 (241)
                      .+||+|....|-++|+
T Consensus        69 ~dfW~~L~~~l~~ilg   84 (98)
T PF07655_consen   69 SDFWEDLQKTLQAILG   84 (98)
T ss_pred             CchHHHHHHHHHHHhC
Confidence            3899998888887764


No 5  
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=59.93  E-value=9.4  Score=36.06  Aligned_cols=9  Identities=22%  Similarity=0.442  Sum_probs=5.1

Q ss_pred             hhHHHHhhc
Q 026233           74 QDFSKAMGN   82 (241)
Q Consensus        74 ksLEkAmg~   82 (241)
                      +.+|+-+..
T Consensus       358 ~~ie~~l~~  366 (456)
T PRK10590        358 RDIEKLLKK  366 (456)
T ss_pred             HHHHHHhcC
Confidence            466666553


No 6  
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=57.53  E-value=29  Score=30.21  Aligned_cols=23  Identities=17%  Similarity=0.434  Sum_probs=18.7

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHH
Q 026233          134 GIIDETVQVVLATIGFILLYIYI  156 (241)
Q Consensus       134 ~~~dE~~QvvLAtlgfIllYI~I  156 (241)
                      .+..-++=|+.++-++|++|++|
T Consensus        92 ~~l~R~~~Vl~g~s~l~i~yfvi  114 (163)
T PF06679_consen   92 PMLKRALYVLVGLSALAILYFVI  114 (163)
T ss_pred             cchhhhHHHHHHHHHHHHHHHHH
Confidence            56777777888888899999887


No 7  
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=51.46  E-value=12  Score=37.07  Aligned_cols=6  Identities=17%  Similarity=-0.053  Sum_probs=2.4

Q ss_pred             ccCccc
Q 026233           25 ERNTTR   30 (241)
Q Consensus        25 ~~~~~p   30 (241)
                      ++.|.|
T Consensus       311 E~~ppp  316 (465)
T KOG3973|consen  311 EMVPPP  316 (465)
T ss_pred             cCCCCC
Confidence            333433


No 8  
>PHA00370 III attachment protein
Probab=47.60  E-value=21  Score=33.91  Aligned_cols=7  Identities=29%  Similarity=0.748  Sum_probs=2.9

Q ss_pred             hhhHHHH
Q 026233           73 WQDFSKA   79 (241)
Q Consensus        73 ~ksLEkA   79 (241)
                      |+..-+|
T Consensus        74 W~P~g~~   80 (297)
T PHA00370         74 WKPTGSA   80 (297)
T ss_pred             eeecccc
Confidence            5533333


No 9  
>PF09451 ATG27:  Autophagy-related protein 27;  InterPro: IPR018939 Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. There are more than 25 AuTophaGy-related (ATG) genes that are essential for autophagy, although it is still not known how the autophagosome is made. Atg9 is a potential membrane carrier to deliver lipids that are used to form the vesicle. Atg27 is another transmembrane protein, and is a cycling protein []. It acts as an effector of VPS34 phosphatidylinositol 3-phosphate kinase signalling and regulates the cytoplasm to vacuole transport (Cvt) vesicle formation. It is also required for autophagy-dependent cycling of ATG9. 
Probab=46.84  E-value=53  Score=29.56  Aligned_cols=14  Identities=7%  Similarity=0.256  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHHHHH
Q 026233          142 VVLATIGFILLYIYI  156 (241)
Q Consensus       142 vvLAtlgfIllYI~I  156 (241)
                      +++++|+| ++||.+
T Consensus       207 ~i~~~l~~-~~Y~i~  220 (268)
T PF09451_consen  207 FIILFLFL-AAYLIF  220 (268)
T ss_pred             HHHHHHHH-HHHhhh
Confidence            45555554 666655


No 10 
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=45.95  E-value=15  Score=40.31  Aligned_cols=14  Identities=21%  Similarity=0.264  Sum_probs=8.7

Q ss_pred             CCCceEEEeCCCCC
Q 026233           52 QKNTVACSLGGKDK   65 (241)
Q Consensus        52 ~~~~~vCl~gGKg~   65 (241)
                      ||+...+.-||.|.
T Consensus      1183 RRGgssysgGGYGg 1196 (1282)
T KOG0921|consen 1183 RRGGSSYSGGGYGG 1196 (1282)
T ss_pred             ccCCCCCCCCCcCC
Confidence            56667777766543


No 11 
>COG4371 Predicted membrane protein [Function unknown]
Probab=45.13  E-value=36  Score=32.67  Aligned_cols=7  Identities=14%  Similarity=0.558  Sum_probs=3.3

Q ss_pred             cCCCccc
Q 026233          213 LNTTTWF  219 (241)
Q Consensus       213 ~~~ptww  219 (241)
                      +-.|..|
T Consensus       191 LRHPEyW  197 (334)
T COG4371         191 LRHPEYW  197 (334)
T ss_pred             HcCCcee
Confidence            3345555


No 12 
>PHA00370 III attachment protein
Probab=41.89  E-value=27  Score=33.18  Aligned_cols=7  Identities=14%  Similarity=0.121  Sum_probs=3.0

Q ss_pred             ccccchh
Q 026233           41 YNHGLLA   47 (241)
Q Consensus        41 ~~~~~~~   47 (241)
                      |.-|++-
T Consensus        50 ~eGC~Y~   56 (297)
T PHA00370         50 YEGCEYE   56 (297)
T ss_pred             ecCeEEE
Confidence            3444443


No 13 
>PLN03134 glycine-rich RNA-binding protein 4; Provisional
Probab=39.13  E-value=5.5  Score=32.71  Aligned_cols=8  Identities=38%  Similarity=0.356  Sum_probs=3.2

Q ss_pred             CCchhhHH
Q 026233           70 GAPWQDFS   77 (241)
Q Consensus        70 ~~a~ksLE   77 (241)
                      +++-+||+
T Consensus        87 e~A~~Al~   94 (144)
T PLN03134         87 GAATAAIS   94 (144)
T ss_pred             HHHHHHHH
Confidence            33334443


No 14 
>PTZ00146 fibrillarin; Provisional
Probab=37.03  E-value=32  Score=32.26  Aligned_cols=16  Identities=0%  Similarity=-0.108  Sum_probs=8.4

Q ss_pred             ChHHHHHHHHHhcccC
Q 026233          221 GPEKYRRMLRSYRERS  236 (241)
Q Consensus       221 ~p~k~~~~~~~~~~~~  236 (241)
                      +++.+..-++.+|+++
T Consensus       215 q~~il~~na~r~LKpG  230 (293)
T PTZ00146        215 QARIVALNAQYFLKNG  230 (293)
T ss_pred             hHHHHHHHHHHhccCC
Confidence            3334444455567765


No 15 
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=35.95  E-value=36  Score=35.00  Aligned_cols=27  Identities=37%  Similarity=0.610  Sum_probs=20.4

Q ss_pred             HHHhcchhHHHhhhh---hHhHhhcCccch
Q 026233          154 IYIIAGEELTKLGKD---YIKYLLGGSKSV  180 (241)
Q Consensus       154 I~Ii~GeEL~~LarD---yikYll~G~rsv  180 (241)
                      -++|.|+||+.|-.-   ++|.|++|--||
T Consensus       189 sF~i~g~emiCLPQafdlFLKhlVGGLHTV  218 (641)
T KOG3915|consen  189 SFTIEGCELICLPQAFDLFLKHLVGGLHTV  218 (641)
T ss_pred             EEEecCceEEecHHHHHHHHHHHhchHHHH
Confidence            357899999887443   577788988776


No 16 
>PF12301 CD99L2:  CD99 antigen like protein 2;  InterPro: IPR022078  This family of proteins is found in eukaryotes. Proteins in this family are typically between 165 and 237 amino acids in length. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. 
Probab=35.51  E-value=66  Score=28.15  Aligned_cols=11  Identities=36%  Similarity=0.637  Sum_probs=4.5

Q ss_pred             HHHHHHHHHHH
Q 026233          144 LATIGFILLYI  154 (241)
Q Consensus       144 LAtlgfIllYI  154 (241)
                      .|.||-|--||
T Consensus       126 valvGAvsSyi  136 (169)
T PF12301_consen  126 VALVGAVSSYI  136 (169)
T ss_pred             HHHHHHHHHHH
Confidence            34444444443


No 17 
>PF09972 DUF2207:  Predicted membrane protein (DUF2207);  InterPro: IPR018702 This domain has no known function.
Probab=34.87  E-value=1.7e+02  Score=26.95  Aligned_cols=27  Identities=15%  Similarity=0.219  Sum_probs=21.7

Q ss_pred             HhhcCccchhhhHHHHHHHHHHHHhhh
Q 026233          172 YLLGGSKSVRLSNAMDALESFWKTLSD  198 (241)
Q Consensus       172 Yll~G~rsvRLkrAm~~W~~f~~~~t~  198 (241)
                      +-+-+.+|..-.+.+.+|..|-+-+.+
T Consensus       449 ~~~~~~~T~~G~~~~~~~~gfr~~L~d  475 (511)
T PF09972_consen  449 YKVMPRRTPEGAELYAQWKGFRRYLAD  475 (511)
T ss_pred             hhhccccchhHHHHHHHHHHHHHHHhh
Confidence            344577999999999999999888833


No 18 
>KOG3449 consensus 60S acidic ribosomal protein P2 [Translation, ribosomal structure and biogenesis]
Probab=34.10  E-value=1.1e+02  Score=25.62  Aligned_cols=33  Identities=21%  Similarity=0.370  Sum_probs=23.4

Q ss_pred             hHHHHhhccCCCCCHHHHHHHHHHhhhcccCCCC
Q 026233           75 DFSKAMGNLGKGQSIEDVLRQQIQKQEFYDGDGG  108 (241)
Q Consensus        75 sLEkAmg~~Kk~~SieD~L~~qI~K~e~~~GG~G  108 (241)
                      .+++-+... ++++|+|+.-+=++|.-....||+
T Consensus        38 ~i~~visel-~GK~i~ElIA~G~eklAsvpsGGa   70 (112)
T KOG3449|consen   38 RINLVLSEL-KGKDIEELIAAGREKLASVPSGGA   70 (112)
T ss_pred             HHHHHHHHh-cCCCHHHHHHHhHHHHhcCCCCCc
Confidence            355556665 467999999999999955554444


No 19 
>KOG3074 consensus Transcriptional regulator of the PUR family, single-stranded-DNA-binding [Transcription]
Probab=34.08  E-value=29  Score=32.63  Aligned_cols=12  Identities=25%  Similarity=0.418  Sum_probs=8.1

Q ss_pred             HHHHHHHHHhcc
Q 026233          223 EKYRRMLRSYRE  234 (241)
Q Consensus       223 ~k~~~~~~~~~~  234 (241)
                      ..||++|-+|+.
T Consensus       155 aEfrdaLaelle  166 (263)
T KOG3074|consen  155 AEFRDALAELLE  166 (263)
T ss_pred             HHHHHHHHHHHH
Confidence            457777777764


No 20 
>PF12300 DUF3628:  Protein of unknown function (DUF3628);  InterPro: IPR022077  Proteins in this entry are DEAD Box RhlB RNA Helicases found in Xanthomonadaceae bacteria.; GO: 0016817 hydrolase activity, acting on acid anhydrides
Probab=34.01  E-value=71  Score=28.58  Aligned_cols=40  Identities=35%  Similarity=0.549  Sum_probs=17.9

Q ss_pred             CHHHHH---HHHHHhhhcccCCCCCCCCCCCCCC-CCCCCCCCC
Q 026233           88 SIEDVL---RQQIQKQEFYDGDGGKSPPRRGGGG-RGEGGSGES  127 (241)
Q Consensus        88 SieD~L---~~qI~K~e~~~GG~GGn~~~~GGgG-Gggg~sG~S  127 (241)
                      ||-++.   ++|-.-.|+--||+-+.++++.|+| |+|..+|.+
T Consensus        37 SVG~IfreAReqraA~E~RRGggRsg~G~RsG~~~g~G~R~G~~   80 (180)
T PF12300_consen   37 SVGTIFREAREQRAADEQRRGGGRSGPGGRSGSGGGGGRRSGAS   80 (180)
T ss_pred             hHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCCccCCC
Confidence            544444   4444444544455443333444443 434555544


No 21 
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=33.10  E-value=49  Score=32.35  Aligned_cols=18  Identities=6%  Similarity=0.289  Sum_probs=12.7

Q ss_pred             cccchHHHHHHHHHHHHH
Q 026233          132 VSGIIDETVQVVLATIGF  149 (241)
Q Consensus       132 ~~~~~dE~~QvvLAtlgf  149 (241)
                      +.=+.+|-+++++--|.+
T Consensus       112 ~e~s~eE~~~~lfEdLeL  129 (371)
T TIGR02877       112 TEVTLEELFELLFEDLEL  129 (371)
T ss_pred             EEecHHHHHHHHHhhccC
Confidence            445688988888766553


No 22 
>PF12575 DUF3753:  Protein of unknown function (DUF3753);  InterPro: IPR009175 This group represents an uncharacterised conserved protein belonging to poxvirus family I2.
Probab=32.70  E-value=39  Score=26.28  Aligned_cols=20  Identities=20%  Similarity=0.242  Sum_probs=16.4

Q ss_pred             CCCCCCCCcccchHHHHHHH
Q 026233          124 SGESGDEGVSGIIDETVQVV  143 (241)
Q Consensus       124 sG~Sede~~~~~~dE~~Qvv  143 (241)
                      +=.|+|++|.+|.++.+||.
T Consensus        12 Fmss~ddDf~~Fi~vVksVl   31 (72)
T PF12575_consen   12 FMSSSDDDFNNFINVVKSVL   31 (72)
T ss_pred             hcCCCHHHHHHHHHHHHHHH
Confidence            44678889999999999874


No 23 
>PF02957 TT_ORF2:  TT viral ORF2;  InterPro: IPR004118 This entry represents the Gyroviral VP2 protein and TT viral ORF2.  Torque teno virus (TTV) is a nonenveloped and single-stranded DNA virus that was initially isolated from a Japanese patient with hepatitis of unknown aetiology, and which has since been found to infect both healthy and diseased individuals []. Numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF2 is a 150 residue protein of unknown function.  Gyroviruses are small circular single stranded viruses, such as the Chicken anaemia virus. The VP2 protein contains a set of conserved cysteine and histidine residues suggesting a zinc binding domain. VP2 may act as a scaffold protein in virion assembly and may also play a role in intracellular signaling during viral replication.
Probab=32.63  E-value=68  Score=25.54  Aligned_cols=14  Identities=14%  Similarity=0.209  Sum_probs=7.7

Q ss_pred             cchHHHHHHHHHHH
Q 026233          134 GIIDETVQVVLATI  147 (241)
Q Consensus       134 ~~~dE~~QvvLAtl  147 (241)
                      ++=+|-+.-+||.+
T Consensus       105 d~~~~dld~L~aa~  118 (122)
T PF02957_consen  105 DYDEEDLDELFAAA  118 (122)
T ss_pred             CCChHHHHHHhhhh
Confidence            34556666666643


No 24 
>PF04801 Sin_N:  Sin-like protein conserved region;  InterPro: IPR006886 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. RNA polymerase III (Pol III) is a complex consisting of 17 subunits, which synthesizes small RNAs, such as 5S rRNA and tRNAs. Pol III is essential for efficient transcription from both the type 2 VAI and type 3 U6 RNA polymerase III promoters and plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Subunit c5 is a specific peripheric component of RNA polymerase III complex. ; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus
Probab=31.41  E-value=26  Score=33.18  Aligned_cols=24  Identities=25%  Similarity=0.306  Sum_probs=19.9

Q ss_pred             hhHHHhhhhhHhHhhcCccchhhhHH
Q 026233          160 EELTKLGKDYIKYLLGGSKSVRLSNA  185 (241)
Q Consensus       160 eEL~~LarDyikYll~G~rsvRLkrA  185 (241)
                      -|.++.|||||+|+|+..+.  ++|+
T Consensus       332 ~e~~~~aRD~iL~~F~~~~~--v~r~  355 (421)
T PF04801_consen  332 AEQLCRARDYILLLFTKSRY--VKRK  355 (421)
T ss_pred             chhhhhhHHHHHHHhcCCCc--eeHH
Confidence            36888999999999999988  4444


No 25 
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription]
Probab=31.36  E-value=39  Score=34.79  Aligned_cols=21  Identities=24%  Similarity=0.232  Sum_probs=8.4

Q ss_pred             HhhhhhHhHhhcCccchhhhH
Q 026233          164 KLGKDYIKYLLGGSKSVRLSN  184 (241)
Q Consensus       164 ~LarDyikYll~G~rsvRLkr  184 (241)
                      +|-|=+|-=++--.--||+-|
T Consensus       221 KLKRLdI~PvVCnVEQVRiLR  241 (641)
T KOG3915|consen  221 KLKRLDITPVVCNVEQVRILR  241 (641)
T ss_pred             HhhccceeeeeechHHHHHHh
Confidence            333434444444444444333


No 26 
>PRK05865 hypothetical protein; Provisional
Probab=29.87  E-value=2.1e+02  Score=30.71  Aligned_cols=25  Identities=24%  Similarity=0.353  Sum_probs=21.4

Q ss_pred             cCCCccccChHHHHHHHHHhcccCC
Q 026233          213 LNTTTWFDGPEKYRRMLRSYRERSA  237 (241)
Q Consensus       213 ~~~ptww~~p~k~~~~~~~~~~~~~  237 (241)
                      +..|+|.++|.....++.+|++...
T Consensus       590 l~~prw~EdP~~Ll~~i~~~~~~~~  614 (854)
T PRK05865        590 MAATSYADNPELLVRMVAKTLRAVP  614 (854)
T ss_pred             cCCCCcccChHHHHHHHHHHHhccC
Confidence            4479999999999999999997543


No 27 
>PRK07772 single-stranded DNA-binding protein; Provisional
Probab=28.78  E-value=55  Score=28.81  Aligned_cols=11  Identities=18%  Similarity=0.102  Sum_probs=8.6

Q ss_pred             CCCceEEEeCC
Q 026233           52 QKNTVACSLGG   62 (241)
Q Consensus        52 ~~~~~vCl~gG   62 (241)
                      +|...|.+.|=
T Consensus        72 ~KGd~V~V~Gr   82 (186)
T PRK07772         72 TKGMRVIVTGR   82 (186)
T ss_pred             CCCCEEEEEEE
Confidence            57888888883


No 28 
>PF14584 DUF4446:  Protein of unknown function (DUF4446)
Probab=26.89  E-value=3e+02  Score=23.47  Aligned_cols=57  Identities=26%  Similarity=0.370  Sum_probs=39.9

Q ss_pred             HHHHHHHHHHHHHHHhcchhHHHhhhhhHhHhhcCccc-------hhhhHHHHHHHHHHHHhhhc
Q 026233          142 VVLATIGFILLYIYIIAGEELTKLGKDYIKYLLGGSKS-------VRLSNAMDALESFWKTLSDN  199 (241)
Q Consensus       142 vvLAtlgfIllYI~Ii~GeEL~~LarDyikYll~G~rs-------vRLkrAm~~W~~f~~~~t~~  199 (241)
                      ++++.|.+|++.++|+..--|-+|-|.|-.++ +|+--       .++.+.+..+..-.+.+.+.
T Consensus         5 i~l~~l~iilli~~~~~~~kl~kl~r~Y~~lm-~g~~~~~lE~~l~~~~~~~~~~~~~~~~~~~~   68 (151)
T PF14584_consen    5 IGLLVLVIILLILIIILNIKLRKLKRRYDALM-RGKDGKNLEDLLNELFDQIDELKEELEELEKR   68 (151)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-CCCCcccHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45667778888888888889999999998776 33332       35556666666666655544


No 29 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=26.62  E-value=94  Score=27.34  Aligned_cols=16  Identities=31%  Similarity=0.721  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q 026233          141 QVVLATIGFILLYIYI  156 (241)
Q Consensus       141 QvvLAtlgfIllYI~I  156 (241)
                      |++.-.|.|++||+++
T Consensus        55 ~l~w~~I~FliL~~lL   70 (204)
T PRK09174         55 QLLWLAITFGLFYLFM   70 (204)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            8888889999999875


No 30 
>PF03954 Lectin_N:  Hepatic lectin, N-terminal domain;  InterPro: IPR005640 Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. C-type lectins display a wide range of specificities. They require Ca2+ for their activity They are found predominantly but not exclusively in vertebrates. This entry presents N-terminal domain, which is found in C-type lectins.; GO: 0005529 sugar binding, 0016020 membrane
Probab=26.54  E-value=1.4e+02  Score=25.76  Aligned_cols=45  Identities=24%  Similarity=0.485  Sum_probs=36.8

Q ss_pred             HHHHHHHHHHHHHHHhcchhHHHhhhhhHhHhhcCccchhhhHHHHHHHHHHHHhhhchh
Q 026233          142 VVLATIGFILLYIYIIAGEELTKLGKDYIKYLLGGSKSVRLSNAMDALESFWKTLSDNKL  201 (241)
Q Consensus       142 vvLAtlgfIllYI~Ii~GeEL~~LarDyikYll~G~rsvRLkrAm~~W~~f~~~~t~~~~  201 (241)
                      -.|..+||.++-++||               ++-|.++..|++-....+--|-+||.+.+
T Consensus        35 l~LlsLgl~~LLLV~I---------------cVigsQ~~qlq~dl~tLretfsNFssst~   79 (138)
T PF03954_consen   35 LLLLSLGLSLLLLVVI---------------CVIGSQNSQLQRDLRTLRETFSNFSSSTL   79 (138)
T ss_pred             HHHHHHHHHHHHHHHH---------------HhhcCccHHHHHHHHHHHHHHhcccHHHH
Confidence            4678889988888877               68899999999999888877777776633


No 31 
>PF07125 DUF1378:  Protein of unknown function (DUF1378);  InterPro: IPR009808 This entry is represented by Bacteriophage 933W, Orf25. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of hypothetical bacterial and phage proteins of around 59 residues in length. Bacterial members of this family seem to be specific to Enterobacteria. The function of this family is unknown.
Probab=25.55  E-value=1.3e+02  Score=22.67  Aligned_cols=8  Identities=38%  Similarity=0.717  Sum_probs=3.7

Q ss_pred             hHhHhhcC
Q 026233          169 YIKYLLGG  176 (241)
Q Consensus       169 yikYll~G  176 (241)
                      +.+||+.|
T Consensus        16 caLYLvsG   23 (59)
T PF07125_consen   16 CALYLVSG   23 (59)
T ss_pred             HHHHHHhc
Confidence            34455444


No 32 
>PF09323 DUF1980:  Domain of unknown function (DUF1980);  InterPro: IPR015402  Members of this occur in gene pairs with members of PF03773 from PFAM. The N-terminal region contains several predicted transmembrane helix regions while the few invariant residues (G, CxxD, and W) occur in the C-terminal region.  Members of this family are found in a set of prokaryotic hypothetical proteins. Their exact function has not, as yet, been defined. 
Probab=24.90  E-value=94  Score=26.30  Aligned_cols=33  Identities=30%  Similarity=0.593  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHHHHHHhcchhHHHhhhhhHhHhhc
Q 026233          142 VVLATIGFILLYIYIIAGEELTKLGKDYIKYLLG  175 (241)
Q Consensus       142 vvLAtlgfIllYI~Ii~GeEL~~LarDyikYll~  175 (241)
                      .+|...|+.++|+ +++|+-.+.+.-.|..|+.-
T Consensus         5 liL~~~~~l~~~l-~~sG~i~~YI~P~~~~~~~~   37 (182)
T PF09323_consen    5 LILLGFGILLFYL-ILSGKILLYIHPRYIPLLYF   37 (182)
T ss_pred             HHHHHHHHHHHHH-HHhCcHHHHhCccHHHHHHH
Confidence            3566666666666 67899888888888877644


No 33 
>COG1314 SecG Preprotein translocase subunit SecG [Intracellular trafficking and secretion]
Probab=24.16  E-value=1.8e+02  Score=22.83  Aligned_cols=22  Identities=9%  Similarity=0.339  Sum_probs=14.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHh
Q 026233          136 IDETVQVVLATIGFILLYIYII  157 (241)
Q Consensus       136 ~dE~~QvvLAtlgfIllYI~Ii  157 (241)
                      ++..+|-+-+.++++|+-+-|+
T Consensus        47 ~~~~L~r~T~iLa~lF~i~~i~   68 (86)
T COG1314          47 VENFLTRTTAILAVLFFIISLV   68 (86)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Confidence            5566777777777766655543


No 34 
>PRK06241 phosphoenolpyruvate synthase; Validated
Probab=23.88  E-value=55  Score=34.46  Aligned_cols=23  Identities=13%  Similarity=0.372  Sum_probs=20.7

Q ss_pred             cCCCccccChHHHHHHHHHhccc
Q 026233          213 LNTTTWFDGPEKYRRMLRSYRER  235 (241)
Q Consensus       213 ~~~ptww~~p~k~~~~~~~~~~~  235 (241)
                      +..|||.++|+..+.++++|+..
T Consensus       592 l~~p~w~EdP~~l~~~i~~~l~~  614 (871)
T PRK06241        592 ITKPRWREDPSTLVPMILNNIKN  614 (871)
T ss_pred             cCCCChhhChHHHHHHHHHHHHh
Confidence            56899999999999999999864


No 35 
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=23.50  E-value=76  Score=29.92  Aligned_cols=6  Identities=17%  Similarity=0.246  Sum_probs=2.5

Q ss_pred             HHHHhh
Q 026233           76 FSKAMG   81 (241)
Q Consensus        76 LEkAmg   81 (241)
                      .++||.
T Consensus       248 A~~Ai~  253 (346)
T TIGR01659       248 AQEAIS  253 (346)
T ss_pred             HHHHHH
Confidence            344444


No 36 
>PF05611 DUF780:  Caenorhabditis elegans protein of unknown function (DUF780);  InterPro: IPR008498 This family consists of several short proteins of unknown function found in Caenorhabditis species.
Probab=22.88  E-value=78  Score=24.63  Aligned_cols=7  Identities=29%  Similarity=0.814  Sum_probs=3.1

Q ss_pred             cccCCCC
Q 026233          102 FYDGDGG  108 (241)
Q Consensus       102 ~~~GG~G  108 (241)
                      ++.||+|
T Consensus        32 YA~ggsg   38 (71)
T PF05611_consen   32 YASGGSG   38 (71)
T ss_pred             hcccCCC
Confidence            3345544


No 37 
>PF13703 PepSY_TM_2:  PepSY-associated TM helix
Probab=22.00  E-value=1.7e+02  Score=21.79  Aligned_cols=50  Identities=16%  Similarity=0.150  Sum_probs=32.0

Q ss_pred             HHHHHHHHHHHHHHHHHhcchhHHH--hhhhhHhHhhcCccchhhhHHHHHHHHHH
Q 026233          140 VQVVLATIGFILLYIYIIAGEELTK--LGKDYIKYLLGGSKSVRLSNAMDALESFW  193 (241)
Q Consensus       140 ~QvvLAtlgfIllYI~Ii~GeEL~~--LarDyikYll~G~rsvRLkrAm~~W~~f~  193 (241)
                      =+.+++++|++++-+. +.|--+.-  ..++.  +-++-+++...++ .++||+..
T Consensus        16 G~~iv~~~al~~l~~~-isGl~l~~p~~~~~~--~~~r~~~~~~~r~-~~dlH~~~   67 (88)
T PF13703_consen   16 GRWIVGILALLLLLLL-ISGLYLWWPRRWRWF--FSLRPKRSKSKRR-WFDLHRVL   67 (88)
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHHhhHHhcCcc--cccccCCCCccCh-HHHHHHHH
Confidence            5678888888777554 46877762  23332  3555555556667 88899864


No 38 
>PRK05325 hypothetical protein; Provisional
Probab=21.62  E-value=92  Score=30.70  Aligned_cols=18  Identities=6%  Similarity=0.263  Sum_probs=12.4

Q ss_pred             cccchHHHHHHHHHHHHH
Q 026233          132 VSGIIDETVQVVLATIGF  149 (241)
Q Consensus       132 ~~~~~dE~~QvvLAtlgf  149 (241)
                      |.=+.+|-+.+++--|++
T Consensus       100 ~els~eE~~~~lfEdLeL  117 (401)
T PRK05325        100 FEISLEELLDLLFEDLEL  117 (401)
T ss_pred             EEecHHHHHHHHHhhcCC
Confidence            446678888887766653


No 39 
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase. Members of this protein family have a novel N-terminal domain, a single predicted membrane-spanning helix, and a predicted cystosolic histidine kinase domain. We designate this protein PrsK, and its companion DNA-binding response regulator protein (TIGR02915) PrsR. These predicted signal-transducing proteins appear to enable enhancer-dependent transcriptional activation. The prsK gene is often associated with exopolysaccharide biosynthesis genes.
Probab=21.40  E-value=3.6e+02  Score=26.82  Aligned_cols=61  Identities=20%  Similarity=0.200  Sum_probs=38.5

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHHhcchhHHHhhhhhHhHhhcCccchhhhHHHHHHHHHHHHhhhc
Q 026233          134 GIIDETVQVVLATIGFILLYIYIIAGEELTKLGKDYIKYLLGGSKSVRLSNAMDALESFWKTLSDN  199 (241)
Q Consensus       134 ~~~dE~~QvvLAtlgfIllYI~Ii~GeEL~~LarDyikYll~G~rsvRLkrAm~~W~~f~~~~t~~  199 (241)
                      +-|..++|+++..++.+++-+.++.+-.--++=+---|.+++-+..-|     ..|-+|.+.+++.
T Consensus       257 g~~~~~~~~~~~~~~~~~~~~~~~s~~lr~~l~~~~~k~~~~~~~dyr-----~~~l~~~~~L~~~  317 (679)
T TIGR02916       257 GEWGDAFQLAFLFAAGLLLAVLLFSGTLRARLRVFISKHFFRYKYDYR-----EEWLRFTQTLSEA  317 (679)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHhccccccchH-----HHHHHHHHHHhCC
Confidence            568888898888888888777777665544433333333333332222     3578888888776


No 40 
>PF14992 TMCO5:  TMCO5 family
Probab=21.23  E-value=1.3e+02  Score=28.55  Aligned_cols=32  Identities=19%  Similarity=0.479  Sum_probs=26.3

Q ss_pred             cchHHHHHHH-------HHHHHHHHHHHHHhcchhHHHh
Q 026233          134 GIIDETVQVV-------LATIGFILLYIYIIAGEELTKL  165 (241)
Q Consensus       134 ~~~dE~~Qvv-------LAtlgfIllYI~Ii~GeEL~~L  165 (241)
                      -+|.=+++.+       ..++|.+|.||+.|+.+-+..+
T Consensus       212 ~~wkr~lr~l~f~vL~f~~LL~y~~f~~~fInpdll~~~  250 (280)
T PF14992_consen  212 TFWKRALRLLFFMVLFFTRLLGYLLFYIQFINPDLLEDV  250 (280)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCcHHHHHH
Confidence            7899999986       3567889999999999887763


No 41 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=21.18  E-value=86  Score=26.14  Aligned_cols=19  Identities=42%  Similarity=0.607  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q 026233          139 TVQVVLATIGFILLYIYII  157 (241)
Q Consensus       139 ~~QvvLAtlgfIllYI~Ii  157 (241)
                      ++=|++++||+||+-.|+|
T Consensus        70 i~gv~aGvIg~Illi~y~i   88 (122)
T PF01102_consen   70 IFGVMAGVIGIILLISYCI   88 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            3444555555555444443


No 42 
>PF09441 Abp2:  ARS binding protein 2;  InterPro: IPR018562  This DNA-binding protein binds to the autonomously replicating sequence (ARS) binding element. It may play a role in regulating the cell cycle response to stress signals []. 
Probab=20.89  E-value=83  Score=28.16  Aligned_cols=35  Identities=26%  Similarity=0.356  Sum_probs=27.9

Q ss_pred             chhhhHHHHHHH--HHHHHhhhchhhhhhhhhhhhccCCC
Q 026233          179 SVRLSNAMDALE--SFWKTLSDNKLVYDKYWLEKEILNTT  216 (241)
Q Consensus       179 svRLkrAm~~W~--~f~~~~t~~~~~~~~~~le~~i~~~p  216 (241)
                      .|||||=|..-|  -|||-++.+   ...||.+-+-...|
T Consensus       100 aVRLKRWM~aMHVDAFFeYllg~---~~~Y~t~iP~~~~~  136 (175)
T PF09441_consen  100 AVRLKRWMRAMHVDAFFEYLLGK---PHPYYTQIPPDNPP  136 (175)
T ss_pred             HHHHHHHHHHhhHHHHHHHHhCC---CCcccccCCCCCCC
Confidence            489999888765  699999999   46899998755544


No 43 
>TIGR01431 adm_rel adenosine deaminase-related growth factor. Members of this family have been described as secreted proteins with growth factor activity and regions of adenosine deaminase homology in insects, mollusks, and vertebrates.
Probab=20.88  E-value=2.1e+02  Score=28.41  Aligned_cols=63  Identities=14%  Similarity=0.133  Sum_probs=40.3

Q ss_pred             CCCCc---ccchHHHHHHHHHHHHHHHHHHHHhcchhHHHhhhhhHhHhhcC--ccchhhhHHHHHHHHHHHHh
Q 026233          128 GDEGV---SGIIDETVQVVLATIGFILLYIYIIAGEELTKLGKDYIKYLLGG--SKSVRLSNAMDALESFWKTL  196 (241)
Q Consensus       128 ede~~---~~~~dE~~QvvLAtlgfIllYI~Ii~GeEL~~LarDyikYll~G--~rsvRLkrAm~~W~~f~~~~  196 (241)
                      ||-++   ++..+|-.|++.+. ++  ..   ..=++|-+||+|.|+|.+-.  .|..++++-=.+|..|++.+
T Consensus       411 DDP~~~~~t~Ls~ef~~a~~~~-~~--~~---~~l~~L~~la~NSi~~Sfl~~~eK~~~~~~~~~~W~~f~~~~  478 (479)
T TIGR01431       411 DDPAFWGATPLSHDFYIAFMGL-AS--AK---ADLRTLKQLALNSIKYSALSEEEKRTALAKWQKQWDKFIDEV  478 (479)
T ss_pred             CCccccCCCCchHHHHHHHHHh-cc--cC---CCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHh
Confidence            55545   25777777766432 10  00   01178999999999998755  45566666667788887764


No 44 
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=20.67  E-value=99  Score=33.92  Aligned_cols=47  Identities=19%  Similarity=0.324  Sum_probs=34.7

Q ss_pred             chhHHHhhhhhHhHhhcCc----cchhhhHHHHHHHHHHHHhhhchhhhhhhhhhh
Q 026233          159 GEELTKLGKDYIKYLLGGS----KSVRLSNAMDALESFWKTLSDNKLVYDKYWLEK  210 (241)
Q Consensus       159 GeEL~~LarDyikYll~G~----rsvRLkrAm~~W~~f~~~~t~~~~~~~~~~le~  210 (241)
                      -++|++=+..+||++++|.    -..|.++||.+|-. ...+|..    |..||++
T Consensus      1019 ~~~~~a~ii~~iR~~~~~~~l~~~~~~v~~a~~~~~~-~~~~t~~----Q~~wl~~ 1069 (1123)
T PRK11448       1019 NEDIAASIIGFIRQAALGDALVPFEERVDHAMQKIYA-ERDWTPV----QRKWLER 1069 (1123)
T ss_pred             hhhHHHHHHHHHHHHhcCCcCCCHHHHHHHHHHHHHH-hCCCCHH----HHHHHHH
Confidence            4566667889999999987    23789999999953 3455544    7788775


No 45 
>PTZ00009 heat shock 70 kDa protein; Provisional
Probab=20.58  E-value=1.5e+02  Score=29.96  Aligned_cols=7  Identities=0%  Similarity=-0.097  Sum_probs=3.1

Q ss_pred             hHHHHhh
Q 026233           75 DFSKAMG   81 (241)
Q Consensus        75 sLEkAmg   81 (241)
                      .+++.|.
T Consensus       578 ~~~~wL~  584 (653)
T PTZ00009        578 EALEWLE  584 (653)
T ss_pred             HHHHHHh
Confidence            3444444


No 46 
>PRK08296 hypothetical protein; Provisional
Probab=20.53  E-value=2.3e+02  Score=29.32  Aligned_cols=22  Identities=18%  Similarity=0.368  Sum_probs=20.3

Q ss_pred             cCCCccccChHHHHHHHHHhcc
Q 026233          213 LNTTTWFDGPEKYRRMLRSYRE  234 (241)
Q Consensus       213 ~~~ptww~~p~k~~~~~~~~~~  234 (241)
                      +..|+|.++|.....++++|++
T Consensus       298 l~~prW~EdP~~ll~~I~~~i~  319 (603)
T PRK08296        298 HHDKSWIDDLEIPLGYIKDYIG  319 (603)
T ss_pred             eCCCChhhChHHHHHHHHHHHH
Confidence            5689999999999999999996


No 47 
>PF07234 DUF1426:  Protein of unknown function (DUF1426);  InterPro: IPR009871 This family consists of several Banana bunchy top virus proteins of around 120 residues in length. Q9IGU4 from SWISSPROT is annotated a movement protein whereas most other family members are hypothetical. The function of this family is unknown.
Probab=20.04  E-value=1.2e+02  Score=25.41  Aligned_cols=30  Identities=30%  Similarity=0.473  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHhcchhHHHhhhhhHhHhhc
Q 026233          146 TIGFILLYIYIIAGEELTKLGKDYIKYLLG  175 (241)
Q Consensus       146 tlgfIllYI~Ii~GeEL~~LarDyikYll~  175 (241)
                      .|++-.+||+++-=-|+-+.+++-.+||+-
T Consensus        22 FiAItIlYILLalL~EvPkYIK~~VrYlVE   51 (117)
T PF07234_consen   22 FIAITILYILLALLFEVPKYIKELVRYLVE   51 (117)
T ss_pred             HHHHHHHHHHHHHHHhhHHHHHHHHHHHHH
Confidence            466777899888888888888888888863


Done!