BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026234
         (241 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EAY|A Chain A, Crystal Structure Of The Human Senp7 Catalytic Domain
          Length = 323

 Score = 35.0 bits (79), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 149 KVLTWIKRKHIFSKKYVLVPIVCWRHWNLLILC 181
           +V TW +  +IF+K Y+ VP+    HW L ++C
Sbjct: 108 RVRTWTRHINIFNKDYIFVPVNESSHWYLAVIC 140


>pdb|2IO0|A Chain A, Crystal Structure Of Human Senp2 In Complex With Presumo-2
 pdb|2IO1|A Chain A, Crystal Structure Of Human Senp2 In Complex With Presumo-3
 pdb|2IO1|C Chain C, Crystal Structure Of Human Senp2 In Complex With Presumo-3
 pdb|2IO1|E Chain E, Crystal Structure Of Human Senp2 In Complex With Presumo-3
 pdb|2IO2|A Chain A, Crystal Structure Of Human Senp2 In Complex With
           Rangap1-sumo-1
 pdb|2IO3|A Chain A, Crystal Structure Of Human Senp2 In Complex With Rangap1-
           Sumo-2
          Length = 232

 Score = 30.4 bits (67), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 11/80 (13%)

Query: 125 DKKAGFTYLD--SLWFDLYRKPSSKAKVLTWIKRKHIFSKKYVLVPIVCWRHWNLLILCN 182
           +KK G+  L   S +F    K      V  W K  ++F ++ +LVPI    HW+L+++  
Sbjct: 70  NKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVI-- 127

Query: 183 FGGSFESKTRTPCMLLLDSL 202
                    R  C+  LDS+
Sbjct: 128 -------DLRKKCLKYLDSM 140


>pdb|1TGZ|A Chain A, Structure Of Human Senp2 In Complex With Sumo-1
 pdb|1TH0|A Chain A, Structure Of Human Senp2
 pdb|1TH0|B Chain B, Structure Of Human Senp2
          Length = 226

 Score = 30.4 bits (67), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 125 DKKAGFTYLD--SLWFDLYRKPSSKAKVLTWIKRKHIFSKKYVLVPIVCWRHWNLLIL-- 180
           +KK G+  L   S +F    K      V  W K  ++F ++ +LVPI    HW+L+++  
Sbjct: 64  NKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDL 123

Query: 181 ----CNFGGSFESKTRTPCMLLLDSLE 203
                 +  S   K    C +LL  L+
Sbjct: 124 RKKCLKYLDSMGQKGHRICEILLQYLQ 150


>pdb|1KTB|A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase
 pdb|1KTC|A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase
          Length = 405

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 160 FSKKYVLVPIVCWRHWN---LLILCNFGGSFES 189
           F+ + VL P     HWN   +LI+ NFG S+E 
Sbjct: 217 FTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQ 249


>pdb|2GLL|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 pdb|2GLL|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 pdb|2GLL|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 pdb|2GLL|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 pdb|2GLL|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 pdb|2GLL|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori
 pdb|2GLM|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 pdb|2GLM|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 pdb|2GLM|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 pdb|2GLM|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 pdb|2GLM|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 pdb|2GLM|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 2
 pdb|2GLP|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 pdb|2GLP|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 pdb|2GLP|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 pdb|2GLP|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 pdb|2GLP|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
 pdb|2GLP|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Compound 1
          Length = 171

 Score = 27.7 bits (60), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 183 FGGSFESKTRTPCMLLLDSLEMSNP-------WRFEPDIRKYVTLYFFGV 225
           F G F +K   P +L+++ +  S         W F+P+I K   +YF  +
Sbjct: 67  FNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTI 116


>pdb|3B7J|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 pdb|3B7J|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 pdb|3B7J|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 pdb|3B7J|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 pdb|3B7J|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 pdb|3B7J|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase(Fabz) From Helicobacter Pylori Complexed
           With Juglone
 pdb|3CF8|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 pdb|3CF8|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 pdb|3CF8|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 pdb|3CF8|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 pdb|3CF8|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 pdb|3CF8|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Quercetin
 pdb|3CF9|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 pdb|3CF9|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 pdb|3CF9|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 pdb|3CF9|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 pdb|3CF9|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 pdb|3CF9|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Apigenin
 pdb|3D04|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 pdb|3D04|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 pdb|3D04|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 pdb|3D04|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 pdb|3D04|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 pdb|3D04|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Sakuranetin
 pdb|3DOY|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 pdb|3DOY|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 pdb|3DOY|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 pdb|3DOY|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 pdb|3DOY|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 pdb|3DOY|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3i
 pdb|3DOZ|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 pdb|3DOZ|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 pdb|3DOZ|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 pdb|3DOZ|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 pdb|3DOZ|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 pdb|3DOZ|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3k
 pdb|3DP0|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 pdb|3DP0|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 pdb|3DP0|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 pdb|3DP0|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 pdb|3DP0|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 pdb|3DP0|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3m
 pdb|3DP1|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 pdb|3DP1|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 pdb|3DP1|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 pdb|3DP1|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 pdb|3DP1|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 pdb|3DP1|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3n
 pdb|3DP2|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 pdb|3DP2|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 pdb|3DP2|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 pdb|3DP2|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 pdb|3DP2|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 pdb|3DP2|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3j
 pdb|3DP3|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 pdb|3DP3|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 pdb|3DP3|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 pdb|3DP3|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 pdb|3DP3|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 pdb|3DP3|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Compound 3q
 pdb|3ED0|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 pdb|3ED0|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 pdb|3ED0|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 pdb|3ED0|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 pdb|3ED0|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
 pdb|3ED0|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
           Dehydratase (Fabz) From Helicobacter Pylori In Complex
           With Emodin
          Length = 159

 Score = 27.7 bits (60), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 183 FGGSFESKTRTPCMLLLDSLEMSNP-------WRFEPDIRKYVTLYFFGV 225
           F G F +K   P +L+++ +  S         W F+P+I K   +YF  +
Sbjct: 55  FNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTI 104


>pdb|1SXJ|E Chain E, Crystal Structure Of The Eukaryotic Clamp Loader
           (Replication Factor C, Rfc) Bound To The Dna Sliding
           Clamp (Proliferating Cell Nuclear Antigen, Pcna)
          Length = 354

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 135 SLWFDLYRKPSSKAKVLTWIKRKHIFSKKYVLVPIVCWRHWNLLILCNFGGSFESKTRTP 194
           SLW D YR  S  A  L+  +    F K     P    R    L+L    G+ +   +T 
Sbjct: 2   SLWVDKYRPKSLNA--LSHNEELTNFLKSLSDQP----RDLPHLLLYGPNGTGK---KTR 52

Query: 195 CMLLLDSLEMSNPWRFEPDIRKYVT 219
           CM LL+S+     +R + D+R++VT
Sbjct: 53  CMALLESIFGPGVYRLKIDVRQFVT 77


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.448 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,872,571
Number of Sequences: 62578
Number of extensions: 259788
Number of successful extensions: 556
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 546
Number of HSP's gapped (non-prelim): 15
length of query: 241
length of database: 14,973,337
effective HSP length: 96
effective length of query: 145
effective length of database: 8,965,849
effective search space: 1300048105
effective search space used: 1300048105
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)