BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026234
(241 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3EAY|A Chain A, Crystal Structure Of The Human Senp7 Catalytic Domain
Length = 323
Score = 35.0 bits (79), Expect = 0.038, Method: Compositional matrix adjust.
Identities = 13/33 (39%), Positives = 21/33 (63%)
Query: 149 KVLTWIKRKHIFSKKYVLVPIVCWRHWNLLILC 181
+V TW + +IF+K Y+ VP+ HW L ++C
Sbjct: 108 RVRTWTRHINIFNKDYIFVPVNESSHWYLAVIC 140
>pdb|2IO0|A Chain A, Crystal Structure Of Human Senp2 In Complex With Presumo-2
pdb|2IO1|A Chain A, Crystal Structure Of Human Senp2 In Complex With Presumo-3
pdb|2IO1|C Chain C, Crystal Structure Of Human Senp2 In Complex With Presumo-3
pdb|2IO1|E Chain E, Crystal Structure Of Human Senp2 In Complex With Presumo-3
pdb|2IO2|A Chain A, Crystal Structure Of Human Senp2 In Complex With
Rangap1-sumo-1
pdb|2IO3|A Chain A, Crystal Structure Of Human Senp2 In Complex With Rangap1-
Sumo-2
Length = 232
Score = 30.4 bits (67), Expect = 0.91, Method: Compositional matrix adjust.
Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 11/80 (13%)
Query: 125 DKKAGFTYLD--SLWFDLYRKPSSKAKVLTWIKRKHIFSKKYVLVPIVCWRHWNLLILCN 182
+KK G+ L S +F K V W K ++F ++ +LVPI HW+L+++
Sbjct: 70 NKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVI-- 127
Query: 183 FGGSFESKTRTPCMLLLDSL 202
R C+ LDS+
Sbjct: 128 -------DLRKKCLKYLDSM 140
>pdb|1TGZ|A Chain A, Structure Of Human Senp2 In Complex With Sumo-1
pdb|1TH0|A Chain A, Structure Of Human Senp2
pdb|1TH0|B Chain B, Structure Of Human Senp2
Length = 226
Score = 30.4 bits (67), Expect = 0.98, Method: Compositional matrix adjust.
Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 8/87 (9%)
Query: 125 DKKAGFTYLD--SLWFDLYRKPSSKAKVLTWIKRKHIFSKKYVLVPIVCWRHWNLLIL-- 180
+KK G+ L S +F K V W K ++F ++ +LVPI HW+L+++
Sbjct: 64 NKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDL 123
Query: 181 ----CNFGGSFESKTRTPCMLLLDSLE 203
+ S K C +LL L+
Sbjct: 124 RKKCLKYLDSMGQKGHRICEILLQYLQ 150
>pdb|1KTB|A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase
pdb|1KTC|A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase
Length = 405
Score = 28.5 bits (62), Expect = 3.8, Method: Compositional matrix adjust.
Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%)
Query: 160 FSKKYVLVPIVCWRHWN---LLILCNFGGSFES 189
F+ + VL P HWN +LI+ NFG S+E
Sbjct: 217 FTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQ 249
>pdb|2GLL|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori
pdb|2GLL|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori
pdb|2GLL|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori
pdb|2GLL|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori
pdb|2GLL|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori
pdb|2GLL|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori
pdb|2GLM|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 2
pdb|2GLM|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 2
pdb|2GLM|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 2
pdb|2GLM|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 2
pdb|2GLM|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 2
pdb|2GLM|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 2
pdb|2GLP|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 1
pdb|2GLP|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 1
pdb|2GLP|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 1
pdb|2GLP|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 1
pdb|2GLP|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 1
pdb|2GLP|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Compound 1
Length = 171
Score = 27.7 bits (60), Expect = 5.4, Method: Compositional matrix adjust.
Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 7/50 (14%)
Query: 183 FGGSFESKTRTPCMLLLDSLEMSNP-------WRFEPDIRKYVTLYFFGV 225
F G F +K P +L+++ + S W F+P+I K +YF +
Sbjct: 67 FNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTI 116
>pdb|3B7J|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Juglone
pdb|3B7J|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Juglone
pdb|3B7J|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Juglone
pdb|3B7J|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Juglone
pdb|3B7J|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Juglone
pdb|3B7J|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase(Fabz) From Helicobacter Pylori Complexed
With Juglone
pdb|3CF8|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Quercetin
pdb|3CF8|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Quercetin
pdb|3CF8|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Quercetin
pdb|3CF8|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Quercetin
pdb|3CF8|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Quercetin
pdb|3CF8|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Quercetin
pdb|3CF9|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Apigenin
pdb|3CF9|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Apigenin
pdb|3CF9|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Apigenin
pdb|3CF9|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Apigenin
pdb|3CF9|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Apigenin
pdb|3CF9|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Apigenin
pdb|3D04|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Sakuranetin
pdb|3D04|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Sakuranetin
pdb|3D04|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Sakuranetin
pdb|3D04|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Sakuranetin
pdb|3D04|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Sakuranetin
pdb|3D04|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Sakuranetin
pdb|3DOY|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3i
pdb|3DOY|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3i
pdb|3DOY|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3i
pdb|3DOY|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3i
pdb|3DOY|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3i
pdb|3DOY|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3i
pdb|3DOZ|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3k
pdb|3DOZ|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3k
pdb|3DOZ|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3k
pdb|3DOZ|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3k
pdb|3DOZ|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3k
pdb|3DOZ|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3k
pdb|3DP0|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3m
pdb|3DP0|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3m
pdb|3DP0|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3m
pdb|3DP0|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3m
pdb|3DP0|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3m
pdb|3DP0|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3m
pdb|3DP1|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3n
pdb|3DP1|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3n
pdb|3DP1|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3n
pdb|3DP1|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3n
pdb|3DP1|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3n
pdb|3DP1|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3n
pdb|3DP2|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3j
pdb|3DP2|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3j
pdb|3DP2|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3j
pdb|3DP2|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3j
pdb|3DP2|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3j
pdb|3DP2|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3j
pdb|3DP3|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3q
pdb|3DP3|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3q
pdb|3DP3|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3q
pdb|3DP3|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3q
pdb|3DP3|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3q
pdb|3DP3|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Compound 3q
pdb|3ED0|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Emodin
pdb|3ED0|B Chain B, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Emodin
pdb|3ED0|C Chain C, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Emodin
pdb|3ED0|D Chain D, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Emodin
pdb|3ED0|E Chain E, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Emodin
pdb|3ED0|F Chain F, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein
Dehydratase (Fabz) From Helicobacter Pylori In Complex
With Emodin
Length = 159
Score = 27.7 bits (60), Expect = 5.4, Method: Compositional matrix adjust.
Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 7/50 (14%)
Query: 183 FGGSFESKTRTPCMLLLDSLEMSNP-------WRFEPDIRKYVTLYFFGV 225
F G F +K P +L+++ + S W F+P+I K +YF +
Sbjct: 55 FNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTI 104
>pdb|1SXJ|E Chain E, Crystal Structure Of The Eukaryotic Clamp Loader
(Replication Factor C, Rfc) Bound To The Dna Sliding
Clamp (Proliferating Cell Nuclear Antigen, Pcna)
Length = 354
Score = 27.7 bits (60), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 9/85 (10%)
Query: 135 SLWFDLYRKPSSKAKVLTWIKRKHIFSKKYVLVPIVCWRHWNLLILCNFGGSFESKTRTP 194
SLW D YR S A L+ + F K P R L+L G+ + +T
Sbjct: 2 SLWVDKYRPKSLNA--LSHNEELTNFLKSLSDQP----RDLPHLLLYGPNGTGK---KTR 52
Query: 195 CMLLLDSLEMSNPWRFEPDIRKYVT 219
CM LL+S+ +R + D+R++VT
Sbjct: 53 CMALLESIFGPGVYRLKIDVRQFVT 77
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.137 0.448
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,872,571
Number of Sequences: 62578
Number of extensions: 259788
Number of successful extensions: 556
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 546
Number of HSP's gapped (non-prelim): 15
length of query: 241
length of database: 14,973,337
effective HSP length: 96
effective length of query: 145
effective length of database: 8,965,849
effective search space: 1300048105
effective search space used: 1300048105
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)