Citrus Sinensis ID: 026239


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MGMAAAAAAAVAESQFHVLAVDDSIIDRKLIERLLKTSSYQVTTVDSGSKALEFLGLHEDDGQSSHSVYPNMHQEVGVNLVITDYCMPGMTGYDLLKKIKESSSLRDIPVVIMSSENVPSRISRCLEEGAEEFFLKPVRLSDLNKLKPHLMKTKIKDQIKQQSQQQQEEESDESDFQSPSPPQQQPQESQQSQQQQQQQQQQQQQQQQQQQQSNNNKRKALEEGLSPERTRPRYNGIATVV
cccHHHHHHHccccccEEEEEcccHHcHHHHHHHHHHcccEEEEEccHHHHHHHHccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
*************SQFHVLAVDDSIIDRKLIERLLKTSSYQVTTVDSGSKALEFLGLHEDDGQSSHSVYPNMHQEVGVNLVITDYCMPGMTGYDLLKKIKESSSLRDIPVVIMSSENVPSRISRCLEEGAEEFFLKPVRLSDLNKLKPHLMK****************************************************************************************V
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMAAAAAAAVAESQFHVLAVDDSIIDRKLIERLLKTSSYQVTTVDSGSKALEFLGLHEDDGQSSHSVYPNMHQEVGVNLVITDYCMPGMTGYDLLKKIKESSSLRDIPVVIMSSENVPSRISRCLEEGAEEFFLKPVRLSDLNKLKPHLMxxxxxxxxxxxxxxxxxxxxxESDFQSPSPPQQQPQExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLSPERTRPRYNGIATVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Two-component response regulator ARR9 Functions as response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Type-A response regulators seem to act as negative regulators of the cytokinin signaling.probableO80366

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W25, chain A
Confidence level:very confident
Coverage over the Query: 16-59,78-154
View the alignment between query and template
View the model in PyMOL
Template: 3GHG, chain C
Confidence level:probable
Coverage over the Query: 137-233
View the alignment between query and template
View the model in PyMOL