BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026251
         (241 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1TY0|A Chain A, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
           J (Spe-J)
 pdb|1TY0|B Chain B, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
           J (Spe-J)
 pdb|1TY0|C Chain C, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
           J (Spe-J)
 pdb|1TY2|A Chain A, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
           J (Spe-J)
 pdb|1TY2|B Chain B, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
           J (Spe-J)
 pdb|1TY2|C Chain C, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
           J (Spe-J)
          Length = 211

 Score = 27.7 bits (60), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 6/56 (10%)

Query: 24  ATRGFSTNSE--KIVASVLFERL---PVVIP-KIDPVVYAFQEFSFRWRQQYRRRY 73
            T   ++NSE  KIV ++L + +    ++ P KID  ++  QEF F+ RQ   + Y
Sbjct: 91  VTPSVNSNSENSKIVGNLLIDGVQQKTLINPIKIDKPIFTIQEFDFKIRQYLMQTY 146


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.408 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,205,663
Number of Sequences: 62578
Number of extensions: 297825
Number of successful extensions: 556
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 556
Number of HSP's gapped (non-prelim): 2
length of query: 241
length of database: 14,973,337
effective HSP length: 96
effective length of query: 145
effective length of database: 8,965,849
effective search space: 1300048105
effective search space used: 1300048105
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)