BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026251
(241 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1TY0|A Chain A, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
J (Spe-J)
pdb|1TY0|B Chain B, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
J (Spe-J)
pdb|1TY0|C Chain C, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
J (Spe-J)
pdb|1TY2|A Chain A, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
J (Spe-J)
pdb|1TY2|B Chain B, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
J (Spe-J)
pdb|1TY2|C Chain C, Crystal Structure Of The Streptococcal Pyrogenic Exotoxin
J (Spe-J)
Length = 211
Score = 27.7 bits (60), Expect = 5.3, Method: Compositional matrix adjust.
Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 6/56 (10%)
Query: 24 ATRGFSTNSE--KIVASVLFERL---PVVIP-KIDPVVYAFQEFSFRWRQQYRRRY 73
T ++NSE KIV ++L + + ++ P KID ++ QEF F+ RQ + Y
Sbjct: 91 VTPSVNSNSENSKIVGNLLIDGVQQKTLINPIKIDKPIFTIQEFDFKIRQYLMQTY 146
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.136 0.408
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,205,663
Number of Sequences: 62578
Number of extensions: 297825
Number of successful extensions: 556
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 556
Number of HSP's gapped (non-prelim): 2
length of query: 241
length of database: 14,973,337
effective HSP length: 96
effective length of query: 145
effective length of database: 8,965,849
effective search space: 1300048105
effective search space used: 1300048105
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)