BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026254
         (241 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DAG|A Chain A, Structure Of The Human Metapneumovirus Fusion Protein With
           Neutralizing Antibody Identifies A Pneumovirus Antigenic
           Site
          Length = 415

 Score = 31.6 bits (70), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 186 LFLWIFGPIPMFVCCCTMSFILYFLDTTSSFTRELHSHSFKEEAKLDDLESPVQS 240
           +F    G +    C    S I   LD T S  REL + S  + A+ + +E+P QS
Sbjct: 30  VFTLEVGDVENLTCTDGPSLIKTELDLTKSALRELKTVSADQLAREEQIENPRQS 84


>pdb|3THT|A Chain A, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|B Chain B, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|C Chain C, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|D Chain D, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
          Length = 345

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 16  LVMGVYHIWLLYTILRFPRRSVIGLNAESRHQWVHSI 52
           +VM   H   +   +  PRRS++ +  ESR+ W H I
Sbjct: 234 IVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGI 270


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.142    0.446 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,034,354
Number of Sequences: 62578
Number of extensions: 208109
Number of successful extensions: 505
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 503
Number of HSP's gapped (non-prelim): 4
length of query: 241
length of database: 14,973,337
effective HSP length: 96
effective length of query: 145
effective length of database: 8,965,849
effective search space: 1300048105
effective search space used: 1300048105
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)