Query         026267
Match_columns 241
No_of_seqs    298 out of 3442
Neff          9.9 
Searched_HMMs 46136
Date          Fri Mar 29 05:47:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026267.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026267hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462 C2H2-type Zn-finger pr 100.0 1.8E-28 3.9E-33  189.7   7.8  135   33-189   127-266 (279)
  2 KOG2462 C2H2-type Zn-finger pr  99.9 1.7E-24 3.7E-29  167.7   7.7  114   60-192   126-241 (279)
  3 KOG3576 Ovo and related transc  99.9 9.1E-22   2E-26  145.5   7.5  117   58-194   111-240 (267)
  4 KOG1074 Transcriptional repres  99.7 1.1E-19 2.3E-24  158.8  -0.3   80  105-191   605-693 (958)
  5 KOG1074 Transcriptional repres  99.7 1.6E-18 3.4E-23  151.6   4.3   60  141-200   880-941 (958)
  6 KOG3623 Homeobox transcription  99.7 1.6E-17 3.5E-22  143.3   4.2  111   64-192   210-335 (1007)
  7 KOG3608 Zn finger proteins [Ge  99.6 5.1E-17 1.1E-21  129.8   0.5  147   42-195   185-350 (467)
  8 KOG3623 Homeobox transcription  99.6   2E-16 4.2E-21  136.7   1.4   78  103-187   892-971 (1007)
  9 KOG3608 Zn finger proteins [Ge  99.6 1.2E-15 2.7E-20  121.9   3.8  154   39-200   210-386 (467)
 10 KOG3576 Ovo and related transc  99.5 1.4E-15   3E-20  112.9   1.2  110   33-162   114-234 (267)
 11 PLN03086 PRLI-interacting fact  99.4 4.6E-13 9.9E-18  116.2   7.8  105   62-192   451-566 (567)
 12 PHA00733 hypothetical protein   99.3 2.1E-12 4.6E-17   92.2   4.1   82  102-192    37-125 (128)
 13 PHA00733 hypothetical protein   99.1 5.3E-11 1.1E-15   85.1   3.9   96   50-164    26-124 (128)
 14 PHA02768 hypothetical protein;  99.1 6.6E-11 1.4E-15   70.1   2.1   42  141-183     6-48  (55)
 15 KOG3993 Transcription factor (  99.0 4.8E-11   1E-15   98.0  -1.7  151   35-192   266-484 (500)
 16 PHA02768 hypothetical protein;  98.8 1.3E-09 2.9E-14   64.6   1.1   44  105-157     5-48  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.8 2.9E-09 6.4E-14   54.0   1.4   26  127-152     1-26  (26)
 18 PLN03086 PRLI-interacting fact  98.8 1.1E-08 2.4E-13   89.2   5.5  113   64-189   407-537 (567)
 19 KOG3993 Transcription factor (  98.7 5.8E-09 1.3E-13   86.0   1.8  113   64-196   267-386 (500)
 20 PHA00732 hypothetical protein   98.4 1.6E-07 3.4E-12   61.1   2.2   45  105-162     1-46  (79)
 21 PHA00616 hypothetical protein   98.4 1.3E-07 2.9E-12   53.4   1.5   32  140-171     1-33  (44)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.4 1.9E-07   4E-12   47.3   1.7   24  155-178     1-26  (26)
 23 PHA00616 hypothetical protein   98.3 2.9E-07 6.3E-12   52.0   1.2   34   64-110     1-34  (44)
 24 PHA00732 hypothetical protein   98.2 1.8E-06 3.9E-11   56.1   3.1   49   64-137     1-49  (79)
 25 PF05605 zf-Di19:  Drought indu  98.1 5.6E-06 1.2E-10   49.9   3.6   47  141-190     3-53  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.0 2.5E-06 5.4E-11   41.8   1.4   23   65-87      1-23  (23)
 27 COG5189 SFP1 Putative transcri  98.0 1.9E-06 4.1E-11   69.0   0.8   51  137-187   346-419 (423)
 28 PF00096 zf-C2H2:  Zinc finger,  97.9 8.5E-06 1.8E-10   39.8   2.3   21  141-161     1-21  (23)
 29 PF05605 zf-Di19:  Drought indu  97.8 1.9E-05 4.2E-10   47.5   3.3   23   64-87      2-24  (54)
 30 COG5189 SFP1 Putative transcri  97.8 4.8E-06   1E-10   66.7   0.4   56  102-162   346-420 (423)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.7 1.6E-05 3.5E-10   39.1   1.5   22  168-189     1-23  (24)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.5E-05 3.2E-10   40.7   0.9   24  167-190     1-25  (27)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.7 2.9E-05 6.3E-10   39.5   1.8   25   64-88      1-25  (27)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.7 2.6E-05 5.7E-10   38.3   1.5   24   65-88      1-24  (24)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.6 3.9E-05 8.4E-10   52.4   2.6   72   66-162     1-72  (100)
 36 PF12756 zf-C2H2_2:  C2H2 type   97.5 4.8E-05   1E-09   51.9   1.9   73  107-190     1-74  (100)
 37 KOG2231 Predicted E3 ubiquitin  97.3 0.00023 5.1E-09   63.5   4.1   40  119-162   189-234 (669)
 38 PF09237 GAGA:  GAGA factor;  I  97.2 0.00048   1E-08   39.9   2.8   31  137-167    21-52  (54)
 39 smart00355 ZnF_C2H2 zinc finge  97.1 0.00033 7.1E-09   34.8   1.7   24   65-88      1-24  (26)
 40 smart00355 ZnF_C2H2 zinc finge  97.0 0.00037 7.9E-09   34.6   1.6   23  168-190     1-24  (26)
 41 KOG1146 Homeobox protein [Gene  97.0  0.0013 2.9E-08   62.4   5.5   66   61-133   462-539 (1406)
 42 PF09237 GAGA:  GAGA factor;  I  96.8 0.00089 1.9E-08   38.8   2.1   29   60-88     20-48  (54)
 43 PF12874 zf-met:  Zinc-finger o  96.8 0.00071 1.5E-08   33.5   1.3   23   65-87      1-23  (25)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.7 0.00091   2E-08   32.8   1.2   22  168-190     1-23  (24)
 45 PRK04860 hypothetical protein;  96.5  0.0011 2.4E-08   49.2   1.2   38  139-180   118-157 (160)
 46 PRK04860 hypothetical protein;  96.5  0.0018   4E-08   48.1   2.3   40  104-154   118-157 (160)
 47 PF12874 zf-met:  Zinc-finger o  96.4  0.0023 5.1E-08   31.6   1.6   22  141-162     1-22  (25)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  96.4  0.0013 2.9E-08   33.3   0.7   22   65-86      2-23  (27)
 49 COG5236 Uncharacterized conser  96.3  0.0035 7.5E-08   51.3   3.1  119   64-196   151-311 (493)
 50 KOG4173 Alpha-SNAP protein [In  96.3  0.0014 3.1E-08   49.5   0.8   83  102-192    76-172 (253)
 51 PF13909 zf-H2C2_5:  C2H2-type   95.9  0.0087 1.9E-07   29.2   2.3   21  141-162     1-21  (24)
 52 PF12171 zf-C2H2_jaz:  Zinc-fin  95.6  0.0027 5.9E-08   32.1  -0.3   21  141-161     2-22  (27)
 53 KOG2231 Predicted E3 ubiquitin  95.0   0.086 1.9E-06   47.7   7.0  103   66-190   184-301 (669)
 54 COG5048 FOG: Zn-finger [Genera  94.6   0.021 4.5E-07   49.2   2.2   61   63-143   288-354 (467)
 55 COG5236 Uncharacterized conser  94.6    0.12 2.6E-06   42.6   6.2   66  124-189   200-274 (493)
 56 COG5048 FOG: Zn-finger [Genera  94.4   0.026 5.6E-07   48.6   2.2   53   36-88    289-347 (467)
 57 KOG2482 Predicted C2H2-type Zn  94.4   0.058 1.3E-06   44.3   4.0   50  141-190   280-358 (423)
 58 PF13913 zf-C2HC_2:  zinc-finge  94.2   0.037   8E-07   27.4   1.6   21   65-86      3-23  (25)
 59 PF13913 zf-C2HC_2:  zinc-finge  94.2   0.044 9.5E-07   27.1   1.9   19  142-161     4-22  (25)
 60 smart00451 ZnF_U1 U1-like zinc  94.1   0.039 8.6E-07   29.5   1.8   23   64-86      3-25  (35)
 61 KOG1146 Homeobox protein [Gene  93.8   0.031 6.7E-07   53.6   1.6   78  102-189   462-541 (1406)
 62 smart00451 ZnF_U1 U1-like zinc  93.8   0.044 9.5E-07   29.3   1.6   22  167-188     3-25  (35)
 63 KOG2893 Zn finger protein [Gen  93.7   0.016 3.5E-07   45.0  -0.3   43  107-160    12-54  (341)
 64 KOG2785 C2H2-type Zn-finger pr  93.3    0.14   3E-06   42.8   4.5   48  141-188   167-242 (390)
 65 KOG2893 Zn finger protein [Gen  93.1   0.028 6.1E-07   43.7   0.2   45  138-186     9-54  (341)
 66 PF12013 DUF3505:  Protein of u  93.1    0.16 3.5E-06   35.2   4.0   25  167-191    80-109 (109)
 67 KOG4377 Zn-finger protein [Gen  93.1    0.17 3.7E-06   42.7   4.6  120   63-193   270-430 (480)
 68 COG4049 Uncharacterized protei  92.6   0.042 9.2E-07   32.4   0.3   30  135-164    12-42  (65)
 69 KOG2186 Cell growth-regulating  92.5     0.1 2.3E-06   41.1   2.5   47  141-189     4-51  (276)
 70 COG4049 Uncharacterized protei  92.4   0.081 1.8E-06   31.3   1.4   29  163-191    13-42  (65)
 71 KOG2482 Predicted C2H2-type Zn  92.0    0.22 4.9E-06   41.0   3.9   53  140-192   195-305 (423)
 72 KOG4173 Alpha-SNAP protein [In  90.4     0.1 2.2E-06   39.8   0.5   79   62-163    77-170 (253)
 73 PF12013 DUF3505:  Protein of u  87.2    0.98 2.1E-05   31.2   3.7   24  141-164    81-109 (109)
 74 PF09538 FYDLN_acid:  Protein o  85.0    0.55 1.2E-05   32.4   1.5   29  141-179    10-39  (108)
 75 COG1997 RPL43A Ribosomal prote  82.8    0.82 1.8E-05   29.9   1.5   35  102-153    32-66  (89)
 76 PF05443 ROS_MUCR:  ROS/MUCR tr  82.7    0.82 1.8E-05   32.8   1.6   19  172-193    78-96  (132)
 77 cd00350 rubredoxin_like Rubred  81.5    0.83 1.8E-05   24.1   1.0   10  139-148    16-25  (33)
 78 PF02892 zf-BED:  BED zinc fing  81.2     1.7 3.7E-05   24.5   2.3   25  137-161    13-41  (45)
 79 KOG2675 Adenylate cyclase-asso  80.8     4.1 8.9E-05   35.1   5.3   13  180-192   197-209 (480)
 80 PF04959 ARS2:  Arsenite-resist  80.7    0.85 1.8E-05   35.6   1.2   30  137-166    74-104 (214)
 81 PF09986 DUF2225:  Uncharacteri  78.3    0.49 1.1E-05   37.1  -0.8   12  168-179    49-61  (214)
 82 smart00614 ZnF_BED BED zinc fi  78.0     1.7 3.6E-05   25.4   1.7   14  140-153    18-31  (50)
 83 KOG4167 Predicted DNA-binding   76.9     2.4 5.1E-05   38.9   2.9   27   62-88    790-816 (907)
 84 PF05443 ROS_MUCR:  ROS/MUCR tr  76.5     2.3 5.1E-05   30.5   2.3   27   60-89     68-94  (132)
 85 PF13717 zinc_ribbon_4:  zinc-r  75.2     2.7 5.8E-05   22.7   1.8   12  142-153     4-15  (36)
 86 TIGR02300 FYDLN_acid conserved  75.0     1.9 4.1E-05   30.5   1.5   29  141-179    10-39  (129)
 87 cd00729 rubredoxin_SM Rubredox  74.8     2.2 4.7E-05   22.7   1.4   10  139-148    17-26  (34)
 88 smart00531 TFIIE Transcription  73.2     3.2 6.9E-05   30.4   2.4   36  138-176    97-133 (147)
 89 TIGR00622 ssl1 transcription f  72.7     3.7 8.1E-05   28.5   2.5   80  103-190    13-105 (112)
 90 PRK00464 nrdR transcriptional   72.5     1.8 3.9E-05   32.0   1.0   17  140-156    28-44  (154)
 91 TIGR00373 conserved hypothetic  71.4     4.1 8.9E-05   30.3   2.7   31  137-175   106-137 (158)
 92 KOG4167 Predicted DNA-binding   69.6     1.5 3.3E-05   40.0   0.1   24  140-163   792-815 (907)
 93 PRK06266 transcription initiat  68.9     4.9 0.00011   30.6   2.6   33  138-178   115-148 (178)
 94 PF09845 DUF2072:  Zn-ribbon co  68.6     2.3 5.1E-05   30.2   0.8   15   64-78      1-15  (131)
 95 smart00734 ZnF_Rad18 Rad18-lik  68.5     4.2   9E-05   20.2   1.5   20   65-85      2-21  (26)
 96 COG1996 RPC10 DNA-directed RNA  68.3       3 6.5E-05   24.2   1.1   11  140-150     6-16  (49)
 97 PF09538 FYDLN_acid:  Protein o  68.0     3.8 8.2E-05   28.3   1.7   32  104-153     8-39  (108)
 98 COG3091 SprT Zn-dependent meta  67.4     2.9 6.3E-05   30.6   1.1   33  138-175   115-149 (156)
 99 COG1592 Rubrerythrin [Energy p  65.9     3.7 7.9E-05   30.7   1.4   25  104-148   133-157 (166)
100 PF15269 zf-C2H2_7:  Zinc-finge  65.5     4.9 0.00011   22.7   1.5   22  141-162    21-42  (54)
101 smart00659 RPOLCX RNA polymera  65.5     5.1 0.00011   22.7   1.6   12  139-150    18-29  (44)
102 PF09986 DUF2225:  Uncharacteri  64.9     2.8   6E-05   32.9   0.6   44  103-153     3-61  (214)
103 COG4957 Predicted transcriptio  64.7     3.8 8.2E-05   29.2   1.2   24  169-195    78-102 (148)
104 TIGR02098 MJ0042_CXXC MJ0042 f  64.3     3.4 7.3E-05   22.4   0.8   15   65-79      3-17  (38)
105 PF03604 DNA_RNApol_7kD:  DNA d  63.6     5.9 0.00013   20.8   1.5   11  140-150    17-27  (32)
106 PRK09678 DNA-binding transcrip  63.2     3.5 7.7E-05   26.2   0.8   39  141-180     2-43  (72)
107 smart00531 TFIIE Transcription  62.7     5.4 0.00012   29.2   1.8   40  102-152    96-135 (147)
108 KOG2071 mRNA cleavage and poly  62.5     6.8 0.00015   35.1   2.6   28   61-88    415-442 (579)
109 PF13719 zinc_ribbon_5:  zinc-r  61.4     7.6 0.00017   21.0   1.8   11  140-150    25-35  (37)
110 KOG2186 Cell growth-regulating  60.8     5.5 0.00012   31.7   1.6   48  105-162     3-50  (276)
111 PRK14890 putative Zn-ribbon RN  60.2     9.9 0.00022   23.0   2.3    9  166-174    47-56  (59)
112 KOG2593 Transcription initiati  59.7     7.9 0.00017   33.3   2.5   34  137-173   125-160 (436)
113 PF04959 ARS2:  Arsenite-resist  58.9     5.7 0.00012   31.1   1.4   30  164-193    74-104 (214)
114 COG2888 Predicted Zn-ribbon RN  58.5     9.4  0.0002   23.1   1.9   31   63-111    26-56  (61)
115 TIGR00373 conserved hypothetic  58.4     9.1  0.0002   28.4   2.4   35  102-152   106-140 (158)
116 TIGR00622 ssl1 transcription f  57.5      21 0.00045   24.8   3.8   89   63-163    14-104 (112)
117 PF01780 Ribosomal_L37ae:  Ribo  57.3     4.9 0.00011   26.7   0.7   32  104-152    34-65  (90)
118 KOG3408 U1-like Zn-finger-cont  57.1     7.4 0.00016   27.3   1.5   24  139-162    56-79  (129)
119 PF10571 UPF0547:  Uncharacteri  57.1       5 0.00011   19.9   0.5   11   65-75     15-25  (26)
120 KOG3408 U1-like Zn-finger-cont  56.9     6.1 0.00013   27.6   1.1   26   61-86     54-79  (129)
121 PF14353 CpXC:  CpXC protein     55.8      11 0.00023   26.8   2.4   18  141-158    39-56  (128)
122 PRK06266 transcription initiat  55.5     6.3 0.00014   29.9   1.1   35  102-152   114-148 (178)
123 KOG2785 C2H2-type Zn-finger pr  55.0      14 0.00031   31.3   3.2   51  105-162   166-242 (390)
124 COG1571 Predicted DNA-binding   54.4     7.2 0.00016   33.7   1.4   29  142-180   352-381 (421)
125 KOG1924 RhoA GTPase effector D  52.2      31 0.00067   32.4   5.0   11  143-153   439-449 (1102)
126 TIGR02605 CxxC_CxxC_SSSS putat  52.0     4.5 9.7E-05   23.6  -0.1    9  140-148    26-34  (52)
127 TIGR00280 L37a ribosomal prote  52.0     7.8 0.00017   25.8   1.0   14  140-153    53-66  (91)
128 smart00834 CxxC_CXXC_SSSS Puta  50.5     6.2 0.00013   21.5   0.3   15   64-78      5-19  (41)
129 KOG3362 Predicted BBOX Zn-fing  50.3     5.2 0.00011   28.9  -0.0   22  167-188   129-151 (156)
130 PRK00398 rpoP DNA-directed RNA  50.0      13 0.00027   21.1   1.6   12  140-151    21-32  (46)
131 PF09723 Zn-ribbon_8:  Zinc rib  49.1     8.5 0.00018   21.5   0.7   10  139-148    25-34  (42)
132 PF04810 zf-Sec23_Sec24:  Sec23  48.2      11 0.00025   20.7   1.2   22  129-150    13-34  (40)
133 PHA00626 hypothetical protein   48.0       9  0.0002   22.9   0.7   14  166-179    22-36  (59)
134 KOG4124 Putative transcription  47.9     3.7 7.9E-05   34.3  -1.2   28   59-87    208-236 (442)
135 COG4957 Predicted transcriptio  47.8      29 0.00063   24.9   3.3   24   63-89     75-98  (148)
136 PF02176 zf-TRAF:  TRAF-type zi  47.5     8.4 0.00018   23.0   0.6   27  126-152    24-54  (60)
137 PF05191 ADK_lid:  Adenylate ki  46.9     8.3 0.00018   20.8   0.4   14  139-152    20-33  (36)
138 PRK03976 rpl37ae 50S ribosomal  46.8      10 0.00023   25.2   1.0   13  140-152    54-66  (90)
139 PF13878 zf-C2H2_3:  zinc-finge  46.5      16 0.00035   20.3   1.6   25   64-88     13-39  (41)
140 PF09963 DUF2197:  Uncharacteri  45.9      11 0.00023   22.6   0.9   10  142-151     4-13  (56)
141 KOG2807 RNA polymerase II tran  44.6      34 0.00074   28.5   3.8   53  138-190   288-369 (378)
142 PF07754 DUF1610:  Domain of un  44.6     8.8 0.00019   18.7   0.3   10   63-72     15-24  (24)
143 PF01363 FYVE:  FYVE zinc finge  44.2      11 0.00024   23.3   0.8   12  139-150    24-35  (69)
144 KOG4124 Putative transcription  44.0      18  0.0004   30.3   2.2   25   61-85    346-372 (442)
145 COG3357 Predicted transcriptio  42.6      15 0.00033   24.3   1.2   15   62-76     56-70  (97)
146 PF06524 NOA36:  NOA36 protein;  42.5      11 0.00023   30.3   0.6   18  166-183   208-226 (314)
147 smart00154 ZnF_AN1 AN1-like Zi  42.5      11 0.00024   20.7   0.5   14   64-77     12-25  (39)
148 COG1198 PriA Primosomal protei  42.0     9.1  0.0002   35.8   0.2   11   66-76    437-447 (730)
149 PRK04351 hypothetical protein;  41.5      12 0.00027   27.4   0.8   33  139-178   111-144 (149)
150 PRK00432 30S ribosomal protein  41.2      17 0.00037   21.2   1.2   12  139-150    36-47  (50)
151 PRK03824 hypA hydrogenase nick  41.0     9.5 0.00021   27.5   0.1   15  139-153    69-83  (135)
152 TIGR01206 lysW lysine biosynth  40.6      12 0.00027   22.2   0.5   10  141-150    23-32  (54)
153 COG2331 Uncharacterized protei  40.5      11 0.00025   24.0   0.4   20   62-85     10-29  (82)
154 cd00924 Cyt_c_Oxidase_Vb Cytoc  40.3      13 0.00029   25.1   0.7   21  132-153    72-92  (97)
155 PTZ00255 60S ribosomal protein  40.2      19  0.0004   24.0   1.4   15  139-153    53-67  (90)
156 COG5151 SSL1 RNA polymerase II  39.9      29 0.00063   28.7   2.7   25  139-163   387-411 (421)
157 PF15135 UPF0515:  Uncharacteri  39.7      24 0.00052   28.2   2.1    8  104-111   111-118 (278)
158 PF05290 Baculo_IE-1:  Baculovi  39.2      32  0.0007   24.6   2.5   18   61-78     77-94  (140)
159 PF09416 UPF1_Zn_bind:  RNA hel  38.7      44 0.00095   24.6   3.2   38  138-175    12-69  (152)
160 KOG2907 RNA polymerase I trans  38.7      21 0.00046   24.7   1.5   12  167-178   102-114 (116)
161 cd00065 FYVE FYVE domain; Zinc  38.7      19 0.00041   21.2   1.2   10  141-150    19-28  (57)
162 PF04780 DUF629:  Protein of un  37.9      24 0.00053   31.1   2.1   25  139-163    56-81  (466)
163 PF08274 PhnA_Zn_Ribbon:  PhnA   37.2      18 0.00038   18.7   0.7   11  139-149    18-28  (30)
164 COG4530 Uncharacterized protei  36.7      21 0.00045   24.6   1.2   15  138-152    24-38  (129)
165 COG4888 Uncharacterized Zn rib  36.1      11 0.00025   25.4  -0.1   12  141-152    47-58  (104)
166 PF11494 Ta0938:  Ta0938;  Inte  35.9      15 0.00032   24.7   0.4   36  138-178    12-49  (105)
167 COG1656 Uncharacterized conser  35.8      41 0.00088   25.1   2.7   21  139-159   129-149 (165)
168 COG1773 Rubredoxin [Energy pro  35.6      17 0.00037   21.7   0.6   15  140-154     3-17  (55)
169 PRK04023 DNA polymerase II lar  35.5      40 0.00086   32.7   3.2   11   63-73    625-635 (1121)
170 KOG2807 RNA polymerase II tran  35.5      42 0.00091   28.0   3.0   25  139-163   344-368 (378)
171 smart00064 FYVE Protein presen  35.5      22 0.00048   21.9   1.2   11  141-151    27-37  (68)
172 PLN03238 probable histone acet  35.4      31 0.00066   28.3   2.2   24  139-162    47-70  (290)
173 smart00440 ZnF_C2C2 C2C2 Zinc   35.4      15 0.00033   20.2   0.4   10  141-150    29-38  (40)
174 KOG2071 mRNA cleavage and poly  35.2      22 0.00047   32.1   1.4   28  164-191   415-443 (579)
175 COG1327 Predicted transcriptio  34.7      17 0.00036   26.7   0.6   14  140-153    28-41  (156)
176 TIGR00595 priA primosomal prot  34.5      14  0.0003   33.1   0.2    9  140-148   253-261 (505)
177 TIGR00244 transcriptional regu  34.4      18 0.00038   26.5   0.6   16  140-155    28-43  (147)
178 PF10263 SprT-like:  SprT-like   34.3      11 0.00025   27.6  -0.4   32  139-177   122-154 (157)
179 PF07975 C1_4:  TFIIH C1-like d  34.2      11 0.00024   22.1  -0.3   27   62-88     19-45  (51)
180 PF08790 zf-LYAR:  LYAR-type C2  33.5      12 0.00026   18.9  -0.2    9  142-150     2-10  (28)
181 PF13451 zf-trcl:  Probable zin  33.5      21 0.00047   20.7   0.8   18  138-155     2-19  (49)
182 KOG3507 DNA-directed RNA polym  33.2      25 0.00054   21.2   1.0   15  139-153    36-50  (62)
183 smart00731 SprT SprT homologue  33.1      16 0.00035   26.6   0.3   32  140-177   112-144 (146)
184 PRK14873 primosome assembly pr  33.0      13 0.00029   34.4  -0.2    9  140-148   422-430 (665)
185 COG1594 RPB9 DNA-directed RNA   32.5      12 0.00025   26.2  -0.5   16   62-77     20-35  (113)
186 PRK12380 hydrogenase nickel in  32.4      25 0.00054   24.5   1.1   12  141-152    71-82  (113)
187 KOG2593 Transcription initiati  32.2      20 0.00043   31.0   0.7   38  102-149   125-162 (436)
188 PRK14873 primosome assembly pr  31.8      33 0.00072   31.9   2.1   28  133-175   403-431 (665)
189 KOG0320 Predicted E3 ubiquitin  31.0      18 0.00039   27.3   0.2   15   99-113   125-139 (187)
190 COG1198 PriA Primosomal protei  31.0      33 0.00071   32.3   1.9   28  134-175   456-484 (730)
191 COG3677 Transposase and inacti  30.7      23 0.00049   25.4   0.7   17  137-153    50-66  (129)
192 PF11781 RRN7:  RNA polymerase   30.6      32 0.00068   18.5   1.1    7  141-147    26-32  (36)
193 PF01096 TFIIS_C:  Transcriptio  30.5      11 0.00023   20.7  -0.8   11  140-150    28-38  (39)
194 KOG0717 Molecular chaperone (D  30.4      33  0.0007   30.1   1.7   38  141-190   293-332 (508)
195 PF07295 DUF1451:  Protein of u  30.3      37  0.0008   24.9   1.7    9  141-149   113-121 (146)
196 PF03811 Zn_Tnp_IS1:  InsA N-te  30.0      29 0.00062   18.7   0.9   19  128-146    17-35  (36)
197 PF10013 DUF2256:  Uncharacteri  29.7      48   0.001   18.6   1.7   16   66-81     10-25  (42)
198 PF12662 cEGF:  Complement Clr-  29.3      30 0.00064   16.8   0.8   12  168-179     2-13  (24)
199 PF01428 zf-AN1:  AN1-like Zinc  29.3      22 0.00047   19.9   0.3   15  139-153    12-26  (43)
200 KOG1280 Uncharacterized conser  28.9      19 0.00041   30.2   0.0   23  140-162    79-101 (381)
201 COG3364 Zn-ribbon containing p  28.1      34 0.00074   23.2   1.1   16   64-79      2-17  (112)
202 PF06220 zf-U1:  U1 zinc finger  27.8      44 0.00096   18.2   1.4   23   63-85      2-26  (38)
203 PTZ00448 hypothetical protein;  27.1      40 0.00087   28.7   1.6   23  140-162   314-336 (373)
204 PRK00564 hypA hydrogenase nick  27.0      33 0.00073   24.0   1.0   13  140-152    71-83  (117)
205 PF11789 zf-Nse:  Zinc-finger o  26.9      33 0.00071   20.6   0.8   35   62-113    22-56  (57)
206 PF06397 Desulfoferrod_N:  Desu  26.8      29 0.00062   18.8   0.5   12  139-150     5-16  (36)
207 PF12907 zf-met2:  Zinc-binding  26.6      34 0.00073   19.0   0.8   22  141-162     2-26  (40)
208 PLN02294 cytochrome c oxidase   26.6      31 0.00066   25.9   0.8   17   61-77    138-154 (174)
209 PF07282 OrfB_Zn_ribbon:  Putat  26.4      54  0.0012   20.2   1.8   15  138-152    44-58  (69)
210 KOG4727 U1-like Zn-finger prot  26.1      42 0.00091   25.2   1.4   24   62-85     73-96  (193)
211 KOG2636 Splicing factor 3a, su  25.9      46   0.001   29.0   1.8   29  134-162   395-424 (497)
212 TIGR00100 hypA hydrogenase nic  25.8      33 0.00071   24.0   0.8   12  141-152    71-82  (115)
213 TIGR00515 accD acetyl-CoA carb  25.6      47   0.001   27.3   1.8   12  140-151    26-37  (285)
214 PF01155 HypA:  Hydrogenase exp  25.1      25 0.00054   24.4   0.1   14  140-153    70-83  (113)
215 PF11672 DUF3268:  Protein of u  24.9      25 0.00055   24.0   0.1    8  141-148    32-39  (102)
216 PF07150 DUF1390:  Protein of u  24.7      20 0.00043   28.4  -0.5   19  140-159     7-25  (229)
217 PF01286 XPA_N:  XPA protein N-  24.7      28 0.00061   18.5   0.2   14   65-78      4-17  (34)
218 PF14446 Prok-RING_1:  Prokaryo  24.7      57  0.0012   19.4   1.5   13  138-150    19-31  (54)
219 KOG0978 E3 ubiquitin ligase in  24.7      30 0.00064   32.1   0.5   21  165-185   676-697 (698)
220 PTZ00064 histone acetyltransfe  24.6      47   0.001   29.6   1.6   26  165-190   278-304 (552)
221 PF10276 zf-CHCC:  Zinc-finger   24.5      45 0.00097   18.5   1.0   12  139-150    28-39  (40)
222 PF04423 Rad50_zn_hook:  Rad50   24.4      27 0.00058   20.6   0.1   13   66-78     22-34  (54)
223 PF05495 zf-CHY:  CHY zinc fing  24.4      13 0.00027   23.5  -1.4   38  130-174    31-69  (71)
224 PLN00104 MYST -like histone ac  24.3      44 0.00095   29.4   1.4   28  164-191   195-223 (450)
225 KOG1842 FYVE finger-containing  23.9      42 0.00091   29.3   1.2   23  140-162    15-37  (505)
226 PTZ00448 hypothetical protein;  23.7      51  0.0011   28.0   1.7   24   63-86    313-336 (373)
227 PF13240 zinc_ribbon_2:  zinc-r  23.6      45 0.00098   15.8   0.8    6  143-148    16-21  (23)
228 CHL00174 accD acetyl-CoA carbo  23.5      57  0.0012   27.0   1.9   13  140-152    38-50  (296)
229 PF13453 zf-TFIIB:  Transcripti  23.4      70  0.0015   17.5   1.7   21  138-158    17-37  (41)
230 KOG2932 E3 ubiquitin ligase in  23.3      69  0.0015   26.6   2.3   16  172-187   153-168 (389)
231 KOG1994 Predicted RNA binding   23.1      47   0.001   26.2   1.2   22  139-160   238-259 (268)
232 PF12760 Zn_Tnp_IS1595:  Transp  22.9 1.1E+02  0.0023   17.2   2.5   11  138-148    35-45  (46)
233 PF09332 Mcm10:  Mcm10 replicat  22.6      27 0.00058   29.5  -0.1   14  139-152   284-297 (344)
234 KOG0402 60S ribosomal protein   22.5      41 0.00089   21.9   0.7   11  141-151    55-65  (92)
235 PRK03681 hypA hydrogenase nick  22.5      50  0.0011   23.0   1.2   12  141-152    71-82  (114)
236 PF08209 Sgf11:  Sgf11 (transcr  22.1      79  0.0017   16.7   1.6   22  168-190     5-27  (33)
237 PF08792 A2L_zn_ribbon:  A2L zi  22.0      71  0.0015   16.8   1.5   12  140-151    21-32  (33)
238 PF07800 DUF1644:  Protein of u  22.0 2.6E+02  0.0057   20.8   4.8   23   63-88     28-50  (162)
239 PF02748 PyrI_C:  Aspartate car  21.9      38 0.00083   19.9   0.4   18   59-76     30-47  (52)
240 KOG2932 E3 ubiquitin ligase in  21.5 1.4E+02   0.003   24.9   3.6   27  138-164   142-172 (389)
241 PF04606 Ogr_Delta:  Ogr/Delta-  21.5      23 0.00051   20.2  -0.5    6  146-151    33-38  (47)
242 PF00301 Rubredoxin:  Rubredoxi  21.5      49  0.0011   19.0   0.8   15  140-154     1-15  (47)
243 COG1675 TFA1 Transcription ini  21.4      59  0.0013   24.7   1.4   10  141-150   133-142 (176)
244 PF01927 Mut7-C:  Mut7-C RNAse   21.3      65  0.0014   23.5   1.7   21  138-158   122-142 (147)
245 PLN02748 tRNA dimethylallyltra  21.3      61  0.0013   28.8   1.8   26   62-87    416-442 (468)
246 KOG0717 Molecular chaperone (D  21.1      53  0.0012   28.9   1.3   21  168-188   293-314 (508)
247 COG5188 PRP9 Splicing factor 3  21.0      65  0.0014   27.2   1.7   29  134-162   368-397 (470)
248 PTZ00303 phosphatidylinositol   20.9      41 0.00089   31.7   0.6   13   65-77    461-473 (1374)
249 cd00730 rubredoxin Rubredoxin;  20.9      40 0.00088   19.7   0.4   13  141-153     2-14  (50)
250 COG5112 UFD2 U1-like Zn-finger  20.7      53  0.0012   22.5   1.0   24  139-162    54-77  (126)
251 KOG0782 Predicted diacylglycer  20.2      22 0.00048   32.0  -1.2   12  142-153   255-266 (1004)

No 1  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.95  E-value=1.8e-28  Score=189.68  Aligned_cols=135  Identities=24%  Similarity=0.426  Sum_probs=122.4

Q ss_pred             CccccCCCCCCCCCCCccccccCccccC---CCCCccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCC
Q 026267           33 PTQKKKRNLPGMPDPDSEVIALSPKTLL---ATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCP  109 (241)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~  109 (241)
                      ...+..+..++........|..|.++|-   ..+.+.|++|||.|.....|+.|+++|.               -++.|.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~---------------l~c~C~  191 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT---------------LPCECG  191 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC---------------CCcccc
Confidence            3455577788888888888999988775   4678999999999999999999999996               678999


Q ss_pred             CCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHHHHh-CCcceecC-CCCCcCCcchHHHHHH
Q 026267          110 ESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKTC-GTREYKCD-CGTIFSRRDSFITHRA  187 (241)
Q Consensus       110 ~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~~-~~k~~~C~-C~k~f~~~~~L~~H~~  187 (241)
                      +|       |+.|...+-|+.|+++|||||||.|..|+|.|..+++|+.||++| +.|.|.|. |+|.|...+-|.+|..
T Consensus       192 iC-------GKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  192 IC-------GKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cc-------cccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            99       999999999999999999999999999999999999999999995 78999999 9999999999999987


Q ss_pred             hc
Q 026267          188 FC  189 (241)
Q Consensus       188 ~~  189 (241)
                      .-
T Consensus       265 S~  266 (279)
T KOG2462|consen  265 SA  266 (279)
T ss_pred             hc
Confidence            53


No 2  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.91  E-value=1.7e-24  Score=167.67  Aligned_cols=114  Identities=22%  Similarity=0.509  Sum_probs=104.5

Q ss_pred             CCCCCccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCc
Q 026267           60 LATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEK  139 (241)
Q Consensus        60 ~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek  139 (241)
                      .....|+|..||+.+.+.++|.+|.++|..-          ..++.+.|.+|       ++.|.....|+.|+++|+  -
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~----------~s~ka~~C~~C-------~K~YvSmpALkMHirTH~--l  186 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSL----------DSKKAFSCKYC-------GKVYVSMPALKMHIRTHT--L  186 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccc----------cccccccCCCC-------CceeeehHHHhhHhhccC--C
Confidence            3556899999999999999999999999621          14678999999       999999999999999997  6


Q ss_pred             eeecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCCcchHHHHHHhccCc
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSRRDSFITHRAFCDAL  192 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~~~~L~~H~~~~~~~  192 (241)
                      +++|.+|||.|.+...|+.|+|+ +|||||.|. |+|.|...++|+.||++|..+
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~  241 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDV  241 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCC
Confidence            79999999999999999999999 799999999 999999999999999999764


No 3  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.86  E-value=9.1e-22  Score=145.52  Aligned_cols=117  Identities=24%  Similarity=0.560  Sum_probs=107.4

Q ss_pred             ccCCCCCccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccC
Q 026267           58 TLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHG  137 (241)
Q Consensus        58 ~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~  137 (241)
                      +......|.|.+|+|.|.....|.+|++.|.             ..+.|.|..|       ++.|.+...|++|+++|+|
T Consensus       111 sssd~d~ftCrvCgK~F~lQRmlnrh~kch~-------------~vkr~lct~c-------gkgfndtfdlkrh~rthtg  170 (267)
T KOG3576|consen  111 SSSDQDSFTCRVCGKKFGLQRMLNRHLKCHS-------------DVKRHLCTFC-------GKGFNDTFDLKRHTRTHTG  170 (267)
T ss_pred             CCCCCCeeeeehhhhhhhHHHHHHHHhhhcc-------------HHHHHHHhhc-------cCcccchhhhhhhhccccC
Confidence            3345678999999999999999999999998             7789999999       9999999999999999999


Q ss_pred             CceeecccccccccchhhHHHHHHH-hC-----------CcceecC-CCCCcCCcchHHHHHHhccCchh
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKT-CG-----------TREYKCD-CGTIFSRRDSFITHRAFCDALAE  194 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~-~~-----------~k~~~C~-C~k~f~~~~~L~~H~~~~~~~~~  194 (241)
                      .+||+|..|+|.|.++-.|..|.+. ||           +|.|.|+ ||..-.....+..|++.||....
T Consensus       171 vrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  171 VRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             ccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            9999999999999999999999987 75           4779999 99999999999999999997543


No 4  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.75  E-value=1.1e-19  Score=158.78  Aligned_cols=80  Identities=21%  Similarity=0.503  Sum_probs=73.1

Q ss_pred             cccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHHHHhCCcc-----eecC----CCCC
Q 026267          105 VYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKTCGTRE-----YKCD----CGTI  175 (241)
Q Consensus       105 ~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~-----~~C~----C~k~  175 (241)
                      +.+|-+|       .+.+.-.+.|+.|.++|+|||||+|.+||+.|.++.+|+.||-.|..++     |.|.    |-+.
T Consensus       605 PNqCiiC-------~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~k  677 (958)
T KOG1074|consen  605 PNQCIIC-------LRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKK  677 (958)
T ss_pred             ccceeee-------eecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccc
Confidence            4689999       9999999999999999999999999999999999999999999986654     7774    8899


Q ss_pred             cCCcchHHHHHHhccC
Q 026267          176 FSRRDSFITHRAFCDA  191 (241)
Q Consensus       176 f~~~~~L~~H~~~~~~  191 (241)
                      |...-.|..|+++|.+
T Consensus       678 ftn~V~lpQhIriH~~  693 (958)
T KOG1074|consen  678 FTNAVTLPQHIRIHLG  693 (958)
T ss_pred             ccccccccceEEeecC
Confidence            9999999999999974


No 5  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.73  E-value=1.6e-18  Score=151.62  Aligned_cols=60  Identities=23%  Similarity=0.500  Sum_probs=54.5

Q ss_pred             eecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCCcchHHHHHHhccCchhhhcccC
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSRRDSFITHRAFCDALAEESARTR  200 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~~~~L~~H~~~~~~~~~~~~~~~  200 (241)
                      ..|.+||+.|...+.|..|+++ +|+|+|.|. |++.|..+..|+.||.+|+-....+.++.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~srrG~  941 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSRRGP  941 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCccCCC
Confidence            4699999999999999999999 699999999 99999999999999999998866666533


No 6  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.68  E-value=1.6e-17  Score=143.29  Aligned_cols=111  Identities=21%  Similarity=0.520  Sum_probs=98.8

Q ss_pred             CccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhcccc-------
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKH-------  136 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~-------  136 (241)
                      ...|.+|.+.+.+...|+.|++..+.           ..+.-|.|..|       ...|.+...|.+||.+|.       
T Consensus       210 lltcpycdrgykrltslkeHikyrhe-----------kne~nfsC~lC-------sytFAyRtQLErhm~~hkpg~dqa~  271 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHE-----------KNEPNFSCMLC-------SYTFAYRTQLERHMQLHKPGGDQAI  271 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHh-----------hCCCCCcchhh-------hhhhhhHHHHHHHHHhhcCCCcccc
Confidence            47899999999999999999886541           14567899999       999999999999999885       


Q ss_pred             ------CCceeecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCCcchHHHHHHhccCc
Q 026267          137 ------GEKKYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSRRDSFITHRAFCDAL  192 (241)
Q Consensus       137 ------~ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~~~~L~~H~~~~~~~  192 (241)
                            +.|.|+|.+|||.|..+..|+.|+|+ .|||||.|. |+|+|....++..||-....+
T Consensus       272 sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSSKKCI  335 (1007)
T KOG3623|consen  272 SLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCI  335 (1007)
T ss_pred             cccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccccchh
Confidence                  24789999999999999999999999 599999999 999999999999999876655


No 7  
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.62  E-value=5.1e-17  Score=129.78  Aligned_cols=147  Identities=16%  Similarity=0.256  Sum_probs=114.7

Q ss_pred             CCCCCCCccccccCccccCCCCCccccccccccCChhHHHHHhhhcCC----Cchhhhcch-----------hhhcCccc
Q 026267           42 PGMPDPDSEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNL----PWKLKQRNS-----------KEVRKKVY  106 (241)
Q Consensus        42 ~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~----~~~~~~~~~-----------~~~~~~~~  106 (241)
                      +.....+...+..|.++|.+++...|+.||..|.+...|-.|++..+.    ++.|.....           .......|
T Consensus       185 Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~y  264 (467)
T KOG3608|consen  185 CTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCY  264 (467)
T ss_pred             hhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcc
Confidence            344556777888999999999999999999999999999999876652    222322111           11234678


Q ss_pred             cCCCCCcccCCCCCcCCChhhHhhhhcc-ccCCceeecccccccccchhhHHHHHHHhCCcceecC---CCCCcCCcchH
Q 026267          107 VCPESTCVHHNPARALGDLTGIKKHFSR-KHGEKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD---CGTIFSRRDSF  182 (241)
Q Consensus       107 ~C~~C~c~~~~~~~~f~~~~~l~~H~~~-h~~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~---C~k~f~~~~~L  182 (241)
                      +|+.|       .......+.|..|++. |...|||+|+.|++.|.+.+.|.+|..+|.+-.|.|+   |...|++...|
T Consensus       265 kCplC-------dmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  265 KCPLC-------DMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             ccccc-------ccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHH
Confidence            88888       7888888888888774 6678899999999999999999999888887889995   99999999999


Q ss_pred             HHHHHhccCchhh
Q 026267          183 ITHRAFCDALAEE  195 (241)
Q Consensus       183 ~~H~~~~~~~~~~  195 (241)
                      ++|++.+|....+
T Consensus       338 ~~H~~evhEg~np  350 (467)
T KOG3608|consen  338 RRHFLEVHEGNNP  350 (467)
T ss_pred             HHHHHHhccCCCC
Confidence            9998888754443


No 8  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.60  E-value=2e-16  Score=136.73  Aligned_cols=78  Identities=23%  Similarity=0.602  Sum_probs=50.5

Q ss_pred             CccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCCcc
Q 026267          103 KKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSRRD  180 (241)
Q Consensus       103 ~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~~~  180 (241)
                      ...|.|+.|       ++.|...+.|.+|.--|+|.|||+|.+|.|.|..+..|..|+|. .|||||.|+ |+|+|....
T Consensus       892 ~gmyaCDqC-------DK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSG  964 (1007)
T KOG3623|consen  892 DGMYACDQC-------DKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSG  964 (1007)
T ss_pred             cccchHHHH-------HHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhccccc
Confidence            455666666       66666666666666666666666666666666666666666666 366666666 666666666


Q ss_pred             hHHHHHH
Q 026267          181 SFITHRA  187 (241)
Q Consensus       181 ~L~~H~~  187 (241)
                      ++..||.
T Consensus       965 SYSQHMN  971 (1007)
T KOG3623|consen  965 SYSQHMN  971 (1007)
T ss_pred             chHhhhc
Confidence            6666654


No 9  
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.57  E-value=1.2e-15  Score=121.94  Aligned_cols=154  Identities=21%  Similarity=0.307  Sum_probs=120.6

Q ss_pred             CCCCCCCCCCccccccCc--cccCCCCCccccccccccCChhHHHHHhhhcCCCchhhhc--------------chhhhc
Q 026267           39 RNLPGMPDPDSEVIALSP--KTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQR--------------NSKEVR  102 (241)
Q Consensus        39 ~~~~~~~~~~~~~~~~~~--~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~--------------~~~~~~  102 (241)
                      +..++.-+.....+..|.  ++....++|.|.+|.|.|.+...|+.|+..|...++|...              .-.+..
T Consensus       210 Cp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~  289 (467)
T KOG3608|consen  210 CPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSK  289 (467)
T ss_pred             cchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhcc
Confidence            344444444555555553  3455667899999999999999999998888654443211              112346


Q ss_pred             CccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeeccc--ccccccchhhHHHHHHH-h-C--CcceecC-CCCC
Q 026267          103 KKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCER--CSKKYAVQSDWKAHMKT-C-G--TREYKCD-CGTI  175 (241)
Q Consensus       103 ~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~--C~k~f~~~~~L~~H~~~-~-~--~k~~~C~-C~k~  175 (241)
                      .++|+|+.|       .+.|...+.|.+|..+|. +-.|.|..  |...|....+|++|++. | |  .-+|.|- |++.
T Consensus       290 dkpfKCd~C-------d~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~  361 (467)
T KOG3608|consen  290 DKPFKCDEC-------DTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRF  361 (467)
T ss_pred             CCCccccch-------hhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhh
Confidence            799999999       999999999999999998 78899988  99999999999999998 6 3  3579999 9999


Q ss_pred             cCCcchHHHHHHhccCchhhhcccC
Q 026267          176 FSRRDSFITHRAFCDALAEESARTR  200 (241)
Q Consensus       176 f~~~~~L~~H~~~~~~~~~~~~~~~  200 (241)
                      |.+-.+|..|++..|+..-++.-.+
T Consensus       362 ft~G~~L~~HL~kkH~f~~PsGh~R  386 (467)
T KOG3608|consen  362 FTSGKSLSAHLMKKHGFRLPSGHKR  386 (467)
T ss_pred             hccchhHHHHHHHhhcccCCCCCCc
Confidence            9999999999999998876665433


No 10 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.54  E-value=1.4e-15  Score=112.94  Aligned_cols=110  Identities=23%  Similarity=0.410  Sum_probs=99.4

Q ss_pred             CccccCCCCCCCCCCCccccccCccccCCCCCccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCC
Q 026267           33 PTQKKKRNLPGMPDPDSEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPEST  112 (241)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~  112 (241)
                      ......+..|+..+.-...+.+|.+-|...+.|-|..||+.|.+...|++|+++|+             +-++|+|..| 
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rtht-------------gvrpykc~~c-  179 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHT-------------GVRPYKCSLC-  179 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhcccc-------------Cccccchhhh-
Confidence            34555778888888888889999999999999999999999999999999999999             8999999999 


Q ss_pred             cccCCCCCcCCChhhHhhhhccccC-----------CceeecccccccccchhhHHHHHHH
Q 026267          113 CVHHNPARALGDLTGIKKHFSRKHG-----------EKKYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       113 c~~~~~~~~f~~~~~l~~H~~~h~~-----------ek~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                            ++.|.+...|..|.+.-+|           +|.|.|+.||.+-.....+..|++.
T Consensus       180 ------~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~  234 (267)
T KOG3576|consen  180 ------EKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKL  234 (267)
T ss_pred             ------hHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHh
Confidence                  9999999999999875443           5789999999999999999999998


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.41  E-value=4.6e-13  Score=116.18  Aligned_cols=105  Identities=21%  Similarity=0.444  Sum_probs=90.0

Q ss_pred             CCCccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCcee
Q 026267           62 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKY  141 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~  141 (241)
                      ++.+.|+.|++.|. ...|..|++.|+               +++.|+ |       ++.+ ....|..|+.+|..++++
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H---------------kpv~Cp-C-------g~~~-~R~~L~~H~~thCp~Kpi  505 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH---------------EPLQCP-C-------GVVL-EKEQMVQHQASTCPLRLI  505 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC---------------CCccCC-C-------CCCc-chhHHHhhhhccCCCCce
Confidence            45678999999996 678999999875               679999 8       7655 668999999999999999


Q ss_pred             ecccccccccc----------hhhHHHHHHHhCCcceecC-CCCCcCCcchHHHHHHhccCc
Q 026267          142 KCERCSKKYAV----------QSDWKAHMKTCGTREYKCD-CGTIFSRRDSFITHRAFCDAL  192 (241)
Q Consensus       142 ~C~~C~k~f~~----------~~~L~~H~~~~~~k~~~C~-C~k~f~~~~~L~~H~~~~~~~  192 (241)
                      .|..|++.|..          ...|..|+..+|.+++.|. |++.|+.+ .|..|+...|..
T Consensus       506 ~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~~  566 (567)
T PLN03086        506 TCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAPCDSCGRSVMLK-EMDIHQIAVHQK  566 (567)
T ss_pred             eCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceEccccCCeeeeh-hHHHHHHHhhcC
Confidence            99999999952          4589999999999999999 99999765 689999887753


No 12 
>PHA00733 hypothetical protein
Probab=99.30  E-value=2.1e-12  Score=92.23  Aligned_cols=82  Identities=16%  Similarity=0.310  Sum_probs=68.0

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhh------hhccccCCceeecccccccccchhhHHHHHHHhCCcceecC-CCC
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKK------HFSRKHGEKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGT  174 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~------H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k  174 (241)
                      ..+.+.|.+|       ...|.....|..      |+. +.++++|.|..||+.|.....|..|++.+ +.+|.|. |++
T Consensus        37 ~~~~~~~~~~-------~~~~~~~~~l~~~~~l~~~~~-~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h-~~~~~C~~CgK  107 (128)
T PHA00733         37 EQKRLIRAVV-------KTLIYNPQLLDESSYLYKLLT-SKAVSPYVCPLCLMPFSSSVSLKQHIRYT-EHSKVCPVCGK  107 (128)
T ss_pred             hhhhHHHHHH-------hhhccChhhhcchHHHHhhcc-cCCCCCccCCCCCCcCCCHHHHHHHHhcC-CcCccCCCCCC
Confidence            4678899998       666665554444      433 34589999999999999999999999975 4679999 999


Q ss_pred             CcCCcchHHHHHHhccCc
Q 026267          175 IFSRRDSFITHRAFCDAL  192 (241)
Q Consensus       175 ~f~~~~~L~~H~~~~~~~  192 (241)
                      .|.....|.+|+...|++
T Consensus       108 ~F~~~~sL~~H~~~~h~~  125 (128)
T PHA00733        108 EFRNTDSTLDHVCKKHNI  125 (128)
T ss_pred             ccCCHHHHHHHHHHhcCc
Confidence            999999999999999875


No 13 
>PHA00733 hypothetical protein
Probab=99.12  E-value=5.3e-11  Score=85.06  Aligned_cols=96  Identities=16%  Similarity=0.187  Sum_probs=75.5

Q ss_pred             cccccCccccCCCCCccccccccccCChhHHHHH--hhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhh
Q 026267           50 EVIALSPKTLLATNRFVCEICNKGFQRDQNLQLH--RRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTG  127 (241)
Q Consensus        50 ~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H--~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~  127 (241)
                      +.+..........+++.|.+|.+.|.....|..|  ++.|.          .....++|.|..|       ++.|.....
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~----------~~~~~kPy~C~~C-------gk~Fss~s~   88 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLL----------TSKAVSPYVCPLC-------LMPFSSSVS   88 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhc----------ccCCCCCccCCCC-------CCcCCCHHH
Confidence            3444444444567899999999999887777665  22221          0015789999999       999999999


Q ss_pred             HhhhhccccCCceeecccccccccchhhHHHHHHH-hC
Q 026267          128 IKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKT-CG  164 (241)
Q Consensus       128 l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~-~~  164 (241)
                      |..|++.|  +.+|.|.+|++.|.....|..|+.. |+
T Consensus        89 L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         89 LKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            99999987  4579999999999999999999998 75


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.07  E-value=6.6e-11  Score=70.10  Aligned_cols=42  Identities=24%  Similarity=0.559  Sum_probs=32.2

Q ss_pred             eecccccccccchhhHHHHHHHhCCcceecC-CCCCcCCcchHH
Q 026267          141 YKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSRRDSFI  183 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~~~~L~  183 (241)
                      |.|++||+.|.+.+.|..|+++|. ++|+|. |++.|.+.+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            678888888888888888888865 677887 888887776654


No 15 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.97  E-value=4.8e-11  Score=97.99  Aligned_cols=151  Identities=15%  Similarity=0.178  Sum_probs=110.3

Q ss_pred             cccCCCCCCCCCCCccccccCccccCCCCCccccccccccCChhHHHHHhhhcCCCchhh--------hc----------
Q 026267           35 QKKKRNLPGMPDPDSEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLK--------QR----------   96 (241)
Q Consensus        35 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~--------~~----------   96 (241)
                      .+.-|++|.....|.-.+..|...-.-.--|+|++|+|.|+...||..|.|+|.......        +.          
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            334557777777888888888776666667999999999999999999999996221111        00          


Q ss_pred             --chhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCc-----------------------------------
Q 026267           97 --NSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEK-----------------------------------  139 (241)
Q Consensus        97 --~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek-----------------------------------  139 (241)
                        .........|.|.+|       ++.|.....|++|+.+|...-                                   
T Consensus       346 ~rsg~dss~gi~~C~~C-------~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g  418 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTC-------GKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHG  418 (500)
T ss_pred             cccCCcccCceeecHHh-------hhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccc
Confidence              111123347999999       999999999999988875210                                   


Q ss_pred             -----------eeecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCCcchHHHHHHhccCc
Q 026267          140 -----------KYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSRRDSFITHRAFCDAL  192 (241)
Q Consensus       140 -----------~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~~~~L~~H~~~~~~~  192 (241)
                                 ...|..|+-.+..+..--.|.+. +-+..|.|. |.-.|.....|.+|+...|..
T Consensus       419 ~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hps  484 (500)
T KOG3993|consen  419 DEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPS  484 (500)
T ss_pred             cceeeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChH
Confidence                       01356666666666555555555 566779999 999999999999999998854


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.81  E-value=1.3e-09  Score=64.58  Aligned_cols=44  Identities=14%  Similarity=0.317  Sum_probs=40.1

Q ss_pred             cccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHH
Q 026267          105 VYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWK  157 (241)
Q Consensus       105 ~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~  157 (241)
                      -|.|++|       ++.|.....|..|+++|+  ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~C-------GK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPIC-------GEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchh-------CCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4799999       999999999999999998  7899999999999887653


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.77  E-value=2.9e-09  Score=53.98  Aligned_cols=26  Identities=35%  Similarity=0.875  Sum_probs=21.2

Q ss_pred             hHhhhhccccCCceeecccccccccc
Q 026267          127 GIKKHFSRKHGEKKYKCERCSKKYAV  152 (241)
Q Consensus       127 ~l~~H~~~h~~ek~~~C~~C~k~f~~  152 (241)
                      +|..|+++|+++++|.|.+|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47788888888888888888888863


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.76  E-value=1.1e-08  Score=89.23  Aligned_cols=113  Identities=19%  Similarity=0.364  Sum_probs=81.8

Q ss_pred             CccccccccccCChhHHHHHhhhcCC-Cc-----hhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccC
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRGHNL-PW-----KLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHG  137 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~h~~-~~-----~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~  137 (241)
                      .-.|..|.+.... .+|..|...-.. ..     .|.........++.+.|..|       ++.|. ...|..|+..|+ 
T Consensus       407 ~V~C~NC~~~i~l-~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~C-------gk~f~-~s~LekH~~~~H-  476 (567)
T PLN03086        407 TVECRNCKHYIPS-RSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKC-------GQAFQ-QGEMEKHMKVFH-  476 (567)
T ss_pred             eEECCCCCCccch-hHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCC-------CCccc-hHHHHHHHHhcC-
Confidence            3468888876544 556777643220 01     12222223335677899999       88885 678999999986 


Q ss_pred             CceeecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCC----------cchHHHHHHhc
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSR----------RDSFITHRAFC  189 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~----------~~~L~~H~~~~  189 (241)
                       +++.|. ||+.| .+..|..|+++ ..++++.|. |++.|..          .+.|..|...+
T Consensus       477 -kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        477 -EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC  537 (567)
T ss_pred             -CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc
Confidence             789999 99765 66899999988 689999999 9999952          35788998875


No 19 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.69  E-value=5.8e-09  Score=85.97  Aligned_cols=113  Identities=14%  Similarity=0.340  Sum_probs=75.7

Q ss_pred             CccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceee-
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYK-  142 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~-  142 (241)
                      -|.|..|...|.+...|.+|.-...             ....|+|++|       ++.|.-..+|..|.++|.-..--. 
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RI-------------V~vEYrCPEC-------~KVFsCPANLASHRRWHKPR~eaa~  326 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRI-------------VHVEYRCPEC-------DKVFSCPANLASHRRWHKPRPEAAK  326 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCee-------------EEeeecCCcc-------cccccCchhhhhhhcccCCchhhhh
Confidence            4899999999999999999965443             4567999999       999999999999999996321100 


Q ss_pred             cc-cc-cccccchhhHHHHHHH---hCCcceecC-CCCCcCCcchHHHHHHhccCchhhh
Q 026267          143 CE-RC-SKKYAVQSDWKAHMKT---CGTREYKCD-CGTIFSRRDSFITHRAFCDALAEES  196 (241)
Q Consensus       143 C~-~C-~k~f~~~~~L~~H~~~---~~~k~~~C~-C~k~f~~~~~L~~H~~~~~~~~~~~  196 (241)
                      -. .= .+.-......+.-.|.   ..+..|.|. |+|.|++...|++|+.+|+......
T Consensus       327 a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k  386 (500)
T KOG3993|consen  327 AGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAK  386 (500)
T ss_pred             cCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccch
Confidence            00 00 0000011111111111   123479999 9999999999999999887654443


No 20 
>PHA00732 hypothetical protein
Probab=98.40  E-value=1.6e-07  Score=61.06  Aligned_cols=45  Identities=27%  Similarity=0.508  Sum_probs=27.4

Q ss_pred             cccCCCCCcccCCCCCcCCChhhHhhhhcc-ccCCceeecccccccccchhhHHHHHHH
Q 026267          105 VYVCPESTCVHHNPARALGDLTGIKKHFSR-KHGEKKYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       105 ~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~-h~~ek~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      +|.|..|       ++.|.....|..|++. |.+   +.|..||+.|.   .|..|+++
T Consensus         1 py~C~~C-------gk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPIC-------GFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCC-------CCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhcc
Confidence            3566666       6666666666666663 432   46666666665   35566654


No 21 
>PHA00616 hypothetical protein
Probab=98.40  E-value=1.3e-07  Score=53.35  Aligned_cols=32  Identities=16%  Similarity=0.428  Sum_probs=22.1

Q ss_pred             eeecccccccccchhhHHHHHHH-hCCcceecC
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD  171 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~  171 (241)
                      +|.|..||+.|..++.|..|++. ||++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            46677777777777777777776 677766664


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.38  E-value=1.9e-07  Score=47.30  Aligned_cols=24  Identities=46%  Similarity=1.041  Sum_probs=21.5

Q ss_pred             hHHHHHHH-hCCcceecC-CCCCcCC
Q 026267          155 DWKAHMKT-CGTREYKCD-CGTIFSR  178 (241)
Q Consensus       155 ~L~~H~~~-~~~k~~~C~-C~k~f~~  178 (241)
                      +|.+|+++ +|+|+|.|+ |++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            58899999 699999999 9999964


No 23 
>PHA00616 hypothetical protein
Probab=98.28  E-value=2.9e-07  Score=51.96  Aligned_cols=34  Identities=12%  Similarity=0.252  Sum_probs=30.6

Q ss_pred             CccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCC
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPE  110 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~  110 (241)
                      +|+|..||+.|....+|..|++.|+             +++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~h-------------g~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVH-------------KQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhc-------------CCCccceeE
Confidence            5899999999999999999999999             778887754


No 24 
>PHA00732 hypothetical protein
Probab=98.16  E-value=1.8e-06  Score=56.13  Aligned_cols=49  Identities=22%  Similarity=0.429  Sum_probs=40.0

Q ss_pred             CccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccC
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHG  137 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~  137 (241)
                      +|.|..||+.|.+..+|..|++.++             .  .+.|+.|       ++.|.   .|..|..++..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H-------------~--~~~C~~C-------gKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNH-------------T--LTKCPVC-------NKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhccc-------------C--CCccCCC-------CCEeC---ChhhhhcccCC
Confidence            5899999999999999999998533             1  2579999       89987   57888876654


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.06  E-value=5.6e-06  Score=49.91  Aligned_cols=47  Identities=19%  Similarity=0.440  Sum_probs=27.8

Q ss_pred             eecccccccccchhhHHHHHHH-hC--CcceecC-CCCCcCCcchHHHHHHhcc
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT-CG--TREYKCD-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~-~~--~k~~~C~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      |.|++|++. .....|..|... |.  .+.+.|. |...+..  +|..|+..+|
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~--~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVTD--NLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhhh--HHHHHHHHhc
Confidence            566666663 334566666665 52  2456666 6665442  6667766655


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.03  E-value=2.5e-06  Score=41.79  Aligned_cols=23  Identities=43%  Similarity=0.908  Sum_probs=21.4

Q ss_pred             ccccccccccCChhHHHHHhhhc
Q 026267           65 FVCEICNKGFQRDQNLQLHRRGH   87 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~L~~H~~~h   87 (241)
                      |.|+.|++.|....+|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999864


No 27 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.99  E-value=1.9e-06  Score=68.97  Aligned_cols=51  Identities=33%  Similarity=0.692  Sum_probs=43.7

Q ss_pred             CCceeeccc--ccccccchhhHHHHHHH-h-------------------CCcceecC-CCCCcCCcchHHHHHH
Q 026267          137 GEKKYKCER--CSKKYAVQSDWKAHMKT-C-------------------GTREYKCD-CGTIFSRRDSFITHRA  187 (241)
Q Consensus       137 ~ek~~~C~~--C~k~f~~~~~L~~H~~~-~-------------------~~k~~~C~-C~k~f~~~~~L~~H~~  187 (241)
                      ++|||+|.+  |.|.|.....|+.|+.. |                   ..|||+|+ |+|+|.....|+-|+.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            468999976  99999999999999876 5                   24899999 9999999999998865


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.93  E-value=8.5e-06  Score=39.84  Aligned_cols=21  Identities=43%  Similarity=0.964  Sum_probs=10.9

Q ss_pred             eecccccccccchhhHHHHHH
Q 026267          141 YKCERCSKKYAVQSDWKAHMK  161 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~  161 (241)
                      |.|..|++.|.+...|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            345555555555555555554


No 29 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.84  E-value=1.9e-05  Score=47.53  Aligned_cols=23  Identities=30%  Similarity=0.641  Sum_probs=13.8

Q ss_pred             CccccccccccCChhHHHHHhhhc
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRGH   87 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~h   87 (241)
                      .|.|++|++. .+...|..|....
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~   24 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDE   24 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhH
Confidence            4667777773 3455677775443


No 30 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.82  E-value=4.8e-06  Score=66.68  Aligned_cols=56  Identities=34%  Similarity=0.686  Sum_probs=48.3

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhcccc-------------------CCceeecccccccccchhhHHHHHHH
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKH-------------------GEKKYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~-------------------~ek~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      .+++|+|++-+|     .+.|.....|+-|++.-+                   ..|||+|++|+|+|.....|+.|+..
T Consensus       346 d~KpykCpV~gC-----~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         346 DGKPYKCPVEGC-----NKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             cCceecCCCCCc-----hhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            459999999988     999999999999986422                   24899999999999999999998764


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.75  E-value=1.6e-05  Score=39.09  Aligned_cols=22  Identities=23%  Similarity=0.661  Sum_probs=9.9

Q ss_pred             eecC-CCCCcCCcchHHHHHHhc
Q 026267          168 YKCD-CGTIFSRRDSFITHRAFC  189 (241)
Q Consensus       168 ~~C~-C~k~f~~~~~L~~H~~~~  189 (241)
                      |.|+ |++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            3454 555555555555555444


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.69  E-value=1.5e-05  Score=40.66  Aligned_cols=24  Identities=29%  Similarity=0.671  Sum_probs=14.9

Q ss_pred             ceecC-CCCCcCCcchHHHHHHhcc
Q 026267          167 EYKCD-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       167 ~~~C~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      +|.|. |++.|.+...|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            35666 6666666666666666554


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.66  E-value=2.9e-05  Score=39.53  Aligned_cols=25  Identities=36%  Similarity=0.711  Sum_probs=23.3

Q ss_pred             CccccccccccCChhHHHHHhhhcC
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999998875


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.66  E-value=2.6e-05  Score=38.29  Aligned_cols=24  Identities=42%  Similarity=0.901  Sum_probs=20.1

Q ss_pred             ccccccccccCChhHHHHHhhhcC
Q 026267           65 FVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      |.|++|++.|.+...|..|++.|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999998763


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.63  E-value=3.9e-05  Score=52.35  Aligned_cols=72  Identities=18%  Similarity=0.459  Sum_probs=18.1

Q ss_pred             cccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeeccc
Q 026267           66 VCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCER  145 (241)
Q Consensus        66 ~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~  145 (241)
                      +|..|+..|.....|..|+...+             +-. ..  .        ...+.....+..+.+... ...+.|..
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H-------------~~~-~~--~--------~~~l~~~~~~~~~~~~~~-~~~~~C~~   55 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKH-------------GFD-IP--D--------QKYLVDPNRLLNYLRKKV-KESFRCPY   55 (100)
T ss_dssp             -------------------------------------------------------------------------SSEEBSS
T ss_pred             Ccccccccccccccccccccccc-------------ccc-cc--c--------cccccccccccccccccc-CCCCCCCc
Confidence            48888888888888888886544             111 00  0        111112222333332221 22578888


Q ss_pred             ccccccchhhHHHHHHH
Q 026267          146 CSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       146 C~k~f~~~~~L~~H~~~  162 (241)
                      |++.|.....|..|++.
T Consensus        56 C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   56 CNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SS-EESSHHHHHHHHHH
T ss_pred             cCCCCcCHHHHHHHHcC
Confidence            88888888888888876


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.53  E-value=4.8e-05  Score=51.89  Aligned_cols=73  Identities=15%  Similarity=0.293  Sum_probs=21.7

Q ss_pred             cCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHHHHhCCcceecC-CCCCcCCcchHHHH
Q 026267          107 VCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSRRDSFITH  185 (241)
Q Consensus       107 ~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~~~~L~~H  185 (241)
                      +|..|       +..|.....|..|+...++...-    ....+.....+..+.+..-...+.|. |++.|.....|..|
T Consensus         1 ~C~~C-------~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~H   69 (100)
T PF12756_consen    1 QCLFC-------DESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEH   69 (100)
T ss_dssp             -----------------------------------------------------------SSEEBSSSS-EESSHHHHHHH
T ss_pred             Ccccc-------ccccccccccccccccccccccc----cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHH
Confidence            47888       88999999999999776653211    11222244444445444333479999 99999999999999


Q ss_pred             HHhcc
Q 026267          186 RAFCD  190 (241)
Q Consensus       186 ~~~~~  190 (241)
                      ++.++
T Consensus        70 m~~~~   74 (100)
T PF12756_consen   70 MRSKH   74 (100)
T ss_dssp             HHHTT
T ss_pred             HcCcc
Confidence            99763


No 37 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=97.32  E-value=0.00023  Score=63.49  Aligned_cols=40  Identities=20%  Similarity=0.370  Sum_probs=25.2

Q ss_pred             CCcCCChhhHhhhhccccCCceeecccc------cccccchhhHHHHHHH
Q 026267          119 ARALGDLTGIKKHFSRKHGEKKYKCERC------SKKYAVQSDWKAHMKT  162 (241)
Q Consensus       119 ~~~f~~~~~l~~H~~~h~~ek~~~C~~C------~k~f~~~~~L~~H~~~  162 (241)
                      ...|.....|.+|++.++    |.|..|      +..|.....|..|.+.
T Consensus       189 ~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~  234 (669)
T KOG2231|consen  189 HERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRK  234 (669)
T ss_pred             hhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhh
Confidence            666666667777766554    445555      3456666777777776


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.15  E-value=0.00048  Score=39.85  Aligned_cols=31  Identities=13%  Similarity=0.294  Sum_probs=21.2

Q ss_pred             CCceeecccccccccchhhHHHHHHH-hCCcc
Q 026267          137 GEKKYKCERCSKKYAVQSDWKAHMKT-CGTRE  167 (241)
Q Consensus       137 ~ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k~  167 (241)
                      .+.|-.|.+|+..+.+..+|++|+.. |+.||
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            46788999999999999999999987 87765


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.10  E-value=0.00033  Score=34.78  Aligned_cols=24  Identities=33%  Similarity=0.670  Sum_probs=21.9

Q ss_pred             ccccccccccCChhHHHHHhhhcC
Q 026267           65 FVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            689999999999999999998764


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.05  E-value=0.00037  Score=34.61  Aligned_cols=23  Identities=26%  Similarity=0.787  Sum_probs=16.6

Q ss_pred             eecC-CCCCcCCcchHHHHHHhcc
Q 026267          168 YKCD-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       168 ~~C~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      |.|. |++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            5677 7777777777777777543


No 41 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=96.98  E-value=0.0013  Score=62.39  Aligned_cols=66  Identities=17%  Similarity=0.231  Sum_probs=40.2

Q ss_pred             CCCCccccccccccCChhHHHHHhhhcCCCchhhh------------cchhhhcCccccCCCCCcccCCCCCcCCChhhH
Q 026267           61 ATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ------------RNSKEVRKKVYVCPESTCVHHNPARALGDLTGI  128 (241)
Q Consensus        61 ~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~------------~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l  128 (241)
                      -.+.|+|+.|+..|.....|..|||.-+.......            ........++|.|..|       ...+.....|
T Consensus       462 ~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C-------~~stttng~L  534 (1406)
T KOG1146|consen  462 FFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRAC-------NYSTTTNGNL  534 (1406)
T ss_pred             ccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceee-------eeeeecchHH
Confidence            34788999999999999999999987331110000            0011123456666666       6666666666


Q ss_pred             hhhhc
Q 026267          129 KKHFS  133 (241)
Q Consensus       129 ~~H~~  133 (241)
                      ..|+.
T Consensus       535 sihlq  539 (1406)
T KOG1146|consen  535 SIHLQ  539 (1406)
T ss_pred             HHHHH
Confidence            66654


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.84  E-value=0.00089  Score=38.78  Aligned_cols=29  Identities=21%  Similarity=0.400  Sum_probs=21.2

Q ss_pred             CCCCCccccccccccCChhHHHHHhhhcC
Q 026267           60 LATNRFVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        60 ~~~~~~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      ..+.|..|++|+..+.+..+|++|+..++
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H   48 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRH   48 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHT
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHh
Confidence            35678999999999999999999998776


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.80  E-value=0.00071  Score=33.55  Aligned_cols=23  Identities=43%  Similarity=0.980  Sum_probs=21.1

Q ss_pred             ccccccccccCChhHHHHHhhhc
Q 026267           65 FVCEICNKGFQRDQNLQLHRRGH   87 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~L~~H~~~h   87 (241)
                      |.|..|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999999764


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.67  E-value=0.00091  Score=32.83  Aligned_cols=22  Identities=27%  Similarity=0.502  Sum_probs=11.1

Q ss_pred             eecC-CCCCcCCcchHHHHHHhcc
Q 026267          168 YKCD-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       168 ~~C~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      |.|. |+.... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            4555 555555 555556655554


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=96.50  E-value=0.0011  Score=49.18  Aligned_cols=38  Identities=26%  Similarity=0.687  Sum_probs=29.1

Q ss_pred             ceeecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCCcc
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSRRD  180 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~~~  180 (241)
                      -+|.|. |++   ....+.+|.++ .++++|.|. |+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            368887 887   56677888888 577888888 888876543


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.48  E-value=0.0018  Score=48.05  Aligned_cols=40  Identities=23%  Similarity=0.558  Sum_probs=34.3

Q ss_pred             ccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchh
Q 026267          104 KVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQS  154 (241)
Q Consensus       104 ~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~  154 (241)
                      -+|.|. |       +.   ....+.+|.++|+++++|.|..|+..|....
T Consensus       118 ~~Y~C~-C-------~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-C-------QE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-C-------CC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            479997 8       65   5677899999999999999999999987654


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.39  E-value=0.0023  Score=31.61  Aligned_cols=22  Identities=18%  Similarity=0.812  Sum_probs=13.2

Q ss_pred             eecccccccccchhhHHHHHHH
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      |.|.+|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666553


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.37  E-value=0.0013  Score=33.27  Aligned_cols=22  Identities=32%  Similarity=0.827  Sum_probs=20.4

Q ss_pred             ccccccccccCChhHHHHHhhh
Q 026267           65 FVCEICNKGFQRDQNLQLHRRG   86 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~L~~H~~~   86 (241)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999875


No 49 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.33  E-value=0.0035  Score=51.29  Aligned_cols=119  Identities=18%  Similarity=0.349  Sum_probs=69.1

Q ss_pred             Cccccc--cccccCChhHHHHHhhhcCCCchhhhc----------------------chhhh---c-CccccCCCCCccc
Q 026267           64 RFVCEI--CNKGFQRDQNLQLHRRGHNLPWKLKQR----------------------NSKEV---R-KKVYVCPESTCVH  115 (241)
Q Consensus        64 ~~~C~~--C~~~f~~~~~L~~H~~~h~~~~~~~~~----------------------~~~~~---~-~~~~~C~~C~c~~  115 (241)
                      .|.|+.  |.........|+.|.+..+...-|...                      .....   | +..=.|.+|    
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC----  226 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFC----  226 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCcEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhc----
Confidence            377875  777666678899998775422221110                      00000   0 112256666    


Q ss_pred             CCCCCcCCChhhHhhhhccccCCceeeccccc-------ccccchhhHHHHHHHhCCcceecC---CC----CCcCCcch
Q 026267          116 HNPARALGDLTGIKKHFSRKHGEKKYKCERCS-------KKYAVQSDWKAHMKTCGTREYKCD---CG----TIFSRRDS  181 (241)
Q Consensus       116 ~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~-------k~f~~~~~L~~H~~~~~~k~~~C~---C~----k~f~~~~~  181 (241)
                         ...|-....|..|++..+ |   .|.+|+       +.|..-.+|..|.+.   -.|.|.   |.    ..|.+...
T Consensus       227 ---~~~FYdDDEL~~HcR~~H-E---~ChICD~v~p~~~QYFK~Y~~Le~HF~~---~hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         227 ---KIYFYDDDELRRHCRLRH-E---ACHICDMVGPIRYQYFKSYEDLEAHFRN---AHYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             ---cceecChHHHHHHHHhhh-h---hhhhhhccCccchhhhhCHHHHHHHhhc---CceEEEEEEEecCcEEEeccHHH
Confidence               666666677777766544 2   344443       246666677777665   125662   54    45888889


Q ss_pred             HHHHHHhccCchhhh
Q 026267          182 FITHRAFCDALAEES  196 (241)
Q Consensus       182 L~~H~~~~~~~~~~~  196 (241)
                      |..|+..-|+.....
T Consensus       297 l~~h~~~~h~~~~~~  311 (493)
T COG5236         297 LLEHLTRFHKVNARL  311 (493)
T ss_pred             HHHHHHHHhhccccc
Confidence            999988877765443


No 50 
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=96.29  E-value=0.0014  Score=49.51  Aligned_cols=83  Identities=20%  Similarity=0.500  Sum_probs=67.8

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHHHH-h----------CCcceec
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKT-C----------GTREYKC  170 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~-~----------~~k~~~C  170 (241)
                      ....|.|++-+|     .+.|.....+..|..+-++   -.|.+|.+.|.+...|..|+.. |          |.-.|.|
T Consensus        76 ~~~~~~cqvagc-----~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~C  147 (253)
T KOG4173|consen   76 RVPAFACQVAGC-----CQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQC  147 (253)
T ss_pred             ccccccccccch-----HHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHH
Confidence            345688999888     7888888877788765555   4899999999999999999875 5          5567999


Q ss_pred             --C-CCCCcCCcchHHHHHHhccCc
Q 026267          171 --D-CGTIFSRRDSFITHRAFCDAL  192 (241)
Q Consensus       171 --~-C~k~f~~~~~L~~H~~~~~~~  192 (241)
                        + |+..|.+...-+.|+-..|+.
T Consensus       148 lvEgCt~KFkT~r~RkdH~I~~Hk~  172 (253)
T KOG4173|consen  148 LVEGCTEKFKTSRDRKDHMIRMHKY  172 (253)
T ss_pred             HHHhhhhhhhhhhhhhhHHHHhccC
Confidence              4 999999999999998877653


No 51 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.91  E-value=0.0087  Score=29.21  Aligned_cols=21  Identities=43%  Similarity=0.842  Sum_probs=14.5

Q ss_pred             eecccccccccchhhHHHHHHH
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      |+|..|+.... ...|..|++.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            67788887776 7778888776


No 52 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.58  E-value=0.0027  Score=32.09  Aligned_cols=21  Identities=33%  Similarity=0.860  Sum_probs=10.3

Q ss_pred             eecccccccccchhhHHHHHH
Q 026267          141 YKCERCSKKYAVQSDWKAHMK  161 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~  161 (241)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            345555555555555544443


No 53 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=95.02  E-value=0.086  Score=47.67  Aligned_cols=103  Identities=22%  Similarity=0.420  Sum_probs=57.6

Q ss_pred             cccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecc-
Q 026267           66 VCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCE-  144 (241)
Q Consensus        66 ~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~-  144 (241)
                      .|..|...|.+...|..|++.+                 .|.|..|.- -.....-|.....|..|.+.+|    |.|. 
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~-----------------h~~chfC~~-~~~~neyy~~~~dLe~HfR~~H----flCE~  241 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD-----------------HEFCHFCDY-KTGQNEYYNDYDDLEEHFRKGH----FLCEE  241 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc-----------------eeheeecCc-ccccchhcccchHHHHHhhhcC----ccccc
Confidence            3555555555555555555544                 356666620 0001667888889999988766    7786 


Q ss_pred             -ccc-ccccchhhHHHHHH-----HhCCcceecC------C-CCCcCCcchHHHHHHhcc
Q 026267          145 -RCS-KKYAVQSDWKAHMK-----TCGTREYKCD------C-GTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       145 -~C~-k~f~~~~~L~~H~~-----~~~~k~~~C~------C-~k~f~~~~~L~~H~~~~~  190 (241)
                       .|- +.|.....+..|++     ...++-|.|.      + ...|.....+..|.++-+
T Consensus       242 ~~C~~~~f~~~~~~ei~lk~~~~~~~~e~~~~~~~~r~Gr~s~~~r~~~~~~~~~~~~~~  301 (669)
T KOG2231|consen  242 EFCRTKKFYVAFELEIELKAHNRFIQHEKCYICRPSRPGRPSSRYRGPYRRLESHFRVSD  301 (669)
T ss_pred             cccccceeeehhHHHHHHHhhccccchheeccCCcccCCCCcccccCCcccccccccccc
Confidence             563 44554445555555     3345666662      1 133444445556655544


No 54 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.62  E-value=0.021  Score=49.17  Aligned_cols=61  Identities=23%  Similarity=0.374  Sum_probs=49.4

Q ss_pred             CCccccccccccCChhHHHHHhh--hcCCCchhhhcchhhhcC--ccccCC--CCCcccCCCCCcCCChhhHhhhhcccc
Q 026267           63 NRFVCEICNKGFQRDQNLQLHRR--GHNLPWKLKQRNSKEVRK--KVYVCP--ESTCVHHNPARALGDLTGIKKHFSRKH  136 (241)
Q Consensus        63 ~~~~C~~C~~~f~~~~~L~~H~~--~h~~~~~~~~~~~~~~~~--~~~~C~--~C~c~~~~~~~~f~~~~~l~~H~~~h~  136 (241)
                      .++.|..|...|.....|..|.+  .|.             .+  +++.|.  .|       ++.|.....+..|...|+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~-------------~~~~~~~~~p~~~~-------~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHS-------------GESLKPFSCPYSLC-------GKLFSRNDALKRHILLHT  347 (467)
T ss_pred             cCCCCccccCCccccccccccccccccc-------------cccCCceeeeccCC-------CccccccccccCCccccc
Confidence            46888899999999999999988  677             66  788888  67       888888888888888888


Q ss_pred             CCceeec
Q 026267          137 GEKKYKC  143 (241)
Q Consensus       137 ~ek~~~C  143 (241)
                      +.+++.|
T Consensus       348 ~~~~~~~  354 (467)
T COG5048         348 SISPAKE  354 (467)
T ss_pred             CCCcccc
Confidence            6655444


No 55 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.60  E-value=0.12  Score=42.62  Aligned_cols=66  Identities=15%  Similarity=0.236  Sum_probs=48.6

Q ss_pred             ChhhHhhhhccccCCc----eeecccccccccchhhHHHHHHHhCCcceecC-CC----CCcCCcchHHHHHHhc
Q 026267          124 DLTGIKKHFSRKHGEK----KYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CG----TIFSRRDSFITHRAFC  189 (241)
Q Consensus       124 ~~~~l~~H~~~h~~ek----~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~----k~f~~~~~L~~H~~~~  189 (241)
                      ....|..|...-..+.    .-.|..|.+.|..-+.|.+|+|...|+-|.|+ =+    .-|.....|-+|.+.-
T Consensus       200 ~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~  274 (493)
T COG5236         200 RSSTLRDHKNGGLEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNA  274 (493)
T ss_pred             ecccccccccCCccccCcCCCchhhhccceecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcC
Confidence            4556777765433332    23699999999999999999999446767775 33    3488889999998764


No 56 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.40  E-value=0.026  Score=48.62  Aligned_cols=53  Identities=21%  Similarity=0.291  Sum_probs=45.6

Q ss_pred             ccCCCCCCCCCCCccccccCcc--ccCCC--CCcccc--ccccccCChhHHHHHhhhcC
Q 026267           36 KKKRNLPGMPDPDSEVIALSPK--TLLAT--NRFVCE--ICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        36 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~C~--~C~~~f~~~~~L~~H~~~h~   88 (241)
                      ...+..+.........+..+..  .|..+  +++.|.  .|++.|.....+..|...|.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHT  347 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccccc
Confidence            4556667777777788888888  79999  999999  79999999999999999887


No 57 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=94.38  E-value=0.058  Score=44.28  Aligned_cols=50  Identities=20%  Similarity=0.354  Sum_probs=40.7

Q ss_pred             eecccccccccchhhHHHHHHH-hC---------------------------CcceecC-CCCCcCCcchHHHHHHhcc
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT-CG---------------------------TREYKCD-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~-~~---------------------------~k~~~C~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      .+|-.|.....+...|..||+. |.                           .+.-.|. |.-.|-....|..||.-+.
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~k  358 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVEDK  358 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccccc
Confidence            5899999999889999999987 62                           1123477 9999999999999997654


No 58 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.20  E-value=0.037  Score=27.37  Aligned_cols=21  Identities=29%  Similarity=0.680  Sum_probs=17.1

Q ss_pred             ccccccccccCChhHHHHHhhh
Q 026267           65 FVCEICNKGFQRDQNLQLHRRG   86 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~L~~H~~~   86 (241)
                      ..|+.||+.| ....|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            5799999999 55779999753


No 59 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.16  E-value=0.044  Score=27.11  Aligned_cols=19  Identities=26%  Similarity=0.632  Sum_probs=9.5

Q ss_pred             ecccccccccchhhHHHHHH
Q 026267          142 KCERCSKKYAVQSDWKAHMK  161 (241)
Q Consensus       142 ~C~~C~k~f~~~~~L~~H~~  161 (241)
                      .|..||+.| ..+.|.+|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            455555555 3444555543


No 60 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.07  E-value=0.039  Score=29.50  Aligned_cols=23  Identities=30%  Similarity=0.821  Sum_probs=20.8

Q ss_pred             CccccccccccCChhHHHHHhhh
Q 026267           64 RFVCEICNKGFQRDQNLQLHRRG   86 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~L~~H~~~   86 (241)
                      +|.|++|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999999999999865


No 61 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=93.80  E-value=0.031  Score=53.61  Aligned_cols=78  Identities=17%  Similarity=0.233  Sum_probs=51.0

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHHHH-hCCcceecC-CCCCcCCc
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTIFSRR  179 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~f~~~  179 (241)
                      ..+.|.|+.|       ++.|.....|..||+..+-+-.-  .+|. .+...-.+.+-... .+.++|.|. |...|..+
T Consensus       462 ~~kt~~cpkc-------~~~yk~a~~L~vhmRskhp~~~~--~~c~-~gq~~~~~arg~~~~~~~~p~~C~~C~~stttn  531 (1406)
T KOG1146|consen  462 FFKTLKCPKC-------NWHYKLAQTLGVHMRSKHPESQS--AYCK-AGQNHPRLARGEVYRCPGKPYPCRACNYSTTTN  531 (1406)
T ss_pred             ccccccCCcc-------chhhhhHHHhhhcccccccccch--hHhH-hccccccccccccccCCCCcccceeeeeeeecc
Confidence            4578899999       88999999999998874432111  2221 11111111110111 356899999 99999999


Q ss_pred             chHHHHHHhc
Q 026267          180 DSFITHRAFC  189 (241)
Q Consensus       180 ~~L~~H~~~~  189 (241)
                      ..|.+|++..
T Consensus       532 g~LsihlqS~  541 (1406)
T KOG1146|consen  532 GNLSIHLQSD  541 (1406)
T ss_pred             hHHHHHHHHH
Confidence            9999999875


No 62 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.75  E-value=0.044  Score=29.32  Aligned_cols=22  Identities=23%  Similarity=0.436  Sum_probs=16.8

Q ss_pred             ceecC-CCCCcCCcchHHHHHHh
Q 026267          167 EYKCD-CGTIFSRRDSFITHRAF  188 (241)
Q Consensus       167 ~~~C~-C~k~f~~~~~L~~H~~~  188 (241)
                      +|.|+ |++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788 88888877788888765


No 63 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=93.72  E-value=0.016  Score=45.04  Aligned_cols=43  Identities=26%  Similarity=0.386  Sum_probs=35.3

Q ss_pred             cCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHH
Q 026267          107 VCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHM  160 (241)
Q Consensus       107 ~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~  160 (241)
                      -|.+|       .+.|.....|..|++.    |.|+|.+|.|.+.+--.|..|-
T Consensus        12 wcwyc-------nrefddekiliqhqka----khfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   12 WCWYC-------NREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeeec-------ccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeeh
Confidence            38888       8999999999988875    4499999999888877777763


No 64 
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=93.34  E-value=0.14  Score=42.81  Aligned_cols=48  Identities=25%  Similarity=0.342  Sum_probs=41.2

Q ss_pred             eecccccccccchhhHHHHHHH-hCC-----------------------cceecC-CC---CCcCCcchHHHHHHh
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT-CGT-----------------------REYKCD-CG---TIFSRRDSFITHRAF  188 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~-~~~-----------------------k~~~C~-C~---k~f~~~~~L~~H~~~  188 (241)
                      -.|..|++.|..-.....||.. ||-                       .-|.|- |+   +.|......+.||..
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            4599999999999999999988 752                       337898 99   999999999999976


No 65 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=93.15  E-value=0.028  Score=43.73  Aligned_cols=45  Identities=20%  Similarity=0.514  Sum_probs=36.2

Q ss_pred             CceeecccccccccchhhHHHHHHHhCCcceecC-CCCCcCCcchHHHHH
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSRRDSFITHR  186 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~~~~L~~H~  186 (241)
                      .|+| |.+|.+.|.....|..|++.   |.|+|. |-|..-+--.|..|-
T Consensus         9 ~kpw-cwycnrefddekiliqhqka---khfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKA---KHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhh---ccceeeeehhhhccCCCceeeh
Confidence            4454 88999999999999999986   669999 998866666666663


No 66 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.13  E-value=0.16  Score=35.19  Aligned_cols=25  Identities=24%  Similarity=0.541  Sum_probs=22.6

Q ss_pred             ceec----C-CCCCcCCcchHHHHHHhccC
Q 026267          167 EYKC----D-CGTIFSRRDSFITHRAFCDA  191 (241)
Q Consensus       167 ~~~C----~-C~k~f~~~~~L~~H~~~~~~  191 (241)
                      -|.|    . |++.+.+...|++|++.+|+
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    8 99999999999999999885


No 67 
>KOG4377 consensus Zn-finger protein [General function prediction only]
Probab=93.08  E-value=0.17  Score=42.69  Aligned_cols=120  Identities=14%  Similarity=0.277  Sum_probs=70.3

Q ss_pred             CCccc--cccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCC--
Q 026267           63 NRFVC--EICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGE--  138 (241)
Q Consensus        63 ~~~~C--~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~e--  138 (241)
                      .-|.|  +.|+..+..+..+.+|.++|........ -....-...|.|..-+|     .+   .-+.+..|...|+..  
T Consensus       270 Ehyhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~-dgf~rfs~syhC~~~~C-----~k---sTsdV~~h~nFht~~~n  340 (480)
T KOG4377|consen  270 EHYHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLI-DGFHRFSNSYHCTGQIC-----EK---STSDVLLHDNFHTDKRN  340 (480)
T ss_pred             hhhcccCccccccccchhhhHHHHHHHhhcccccc-cchhhcCccchhhhccc-----Cc---ccccccccCcccccccc
Confidence            34667  3588888888889999988852111100 00111223466655444     55   334556676666532  


Q ss_pred             -----ceeecccccccccchhhHHHHHHHh---------CC--------------------cceecC---CCCCcCCcch
Q 026267          139 -----KKYKCERCSKKYAVQSDWKAHMKTC---------GT--------------------REYKCD---CGTIFSRRDS  181 (241)
Q Consensus       139 -----k~~~C~~C~k~f~~~~~L~~H~~~~---------~~--------------------k~~~C~---C~k~f~~~~~  181 (241)
                           ..|.|..||-++..+  ...|...|         |-                    .-|.|.   |+..|...+.
T Consensus       341 ~GfrrthfhC~r~gCTdtfK--~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sq  418 (480)
T KOG4377|consen  341 NGFRRTHFHCQRIGCTDTFK--DSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQ  418 (480)
T ss_pred             CceecceeEEeccCCccccc--cccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhh
Confidence                 357888877333333  22232212         11                    115564   9999999999


Q ss_pred             HHHHHHhccCch
Q 026267          182 FITHRAFCDALA  193 (241)
Q Consensus       182 L~~H~~~~~~~~  193 (241)
                      +..|.+.|.++.
T Consensus       419 m~shkrkheRqe  430 (480)
T KOG4377|consen  419 MASHKRKHERQE  430 (480)
T ss_pred             hhhhhhhhhhhh
Confidence            999999998873


No 68 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.55  E-value=0.042  Score=32.43  Aligned_cols=30  Identities=27%  Similarity=0.693  Sum_probs=21.9

Q ss_pred             ccCCceeecccccccccchhhHHHHHHH-hC
Q 026267          135 KHGEKKYKCERCSKKYAVQSDWKAHMKT-CG  164 (241)
Q Consensus       135 h~~ek~~~C~~C~k~f~~~~~L~~H~~~-~~  164 (241)
                      --||.-+.|+.||+.|....+..+|... |+
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3466677788888888777777777776 65


No 69 
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=92.46  E-value=0.1  Score=41.06  Aligned_cols=47  Identities=26%  Similarity=0.651  Sum_probs=25.6

Q ss_pred             eecccccccccchhhHHHHHHHhCCcceecC-CCCCcCCcchHHHHHHhc
Q 026267          141 YKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSRRDSFITHRAFC  189 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~~~~L~~H~~~~  189 (241)
                      |.|.+||-...- ..+.+|+......-|.|- |++.|-+ .+++.|..-.
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCI   51 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCI   51 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccCCeeEEeeccccccc-chhhhhhhhc
Confidence            556666655433 345556666222556666 6666655 4555565433


No 70 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.41  E-value=0.081  Score=31.27  Aligned_cols=29  Identities=31%  Similarity=0.710  Sum_probs=22.1

Q ss_pred             hCCcceecC-CCCCcCCcchHHHHHHhccC
Q 026267          163 CGTREYKCD-CGTIFSRRDSFITHRAFCDA  191 (241)
Q Consensus       163 ~~~k~~~C~-C~k~f~~~~~L~~H~~~~~~  191 (241)
                      -||--+.|. |+..|++..++.+|....|+
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            377778888 88888888888888776654


No 71 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=91.99  E-value=0.22  Score=40.99  Aligned_cols=53  Identities=17%  Similarity=0.431  Sum_probs=41.8

Q ss_pred             eeecccccccccchhhHHHHHHH--hCC----------------------------------------------------
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKT--CGT----------------------------------------------------  165 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~--~~~----------------------------------------------------  165 (241)
                      .+.|-.|.+.|..+..|+.||+.  |..                                                    
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            37899999999999999999986  420                                                    


Q ss_pred             -cc--eecC-CCCCcCCcchHHHHHHhccCc
Q 026267          166 -RE--YKCD-CGTIFSRRDSFITHRAFCDAL  192 (241)
Q Consensus       166 -k~--~~C~-C~k~f~~~~~L~~H~~~~~~~  192 (241)
                       .+  ..|- |....-+...|..||+..|..
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~  305 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVHEF  305 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHHHh
Confidence             01  3688 998888888999999988764


No 72 
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=90.44  E-value=0.1  Score=39.83  Aligned_cols=79  Identities=25%  Similarity=0.508  Sum_probs=61.8

Q ss_pred             CCCccccc--cccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhcccc---
Q 026267           62 TNRFVCEI--CNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKH---  136 (241)
Q Consensus        62 ~~~~~C~~--C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~---  136 (241)
                      ...|.|.+  |-+.|.....+..|..+.+             +.   .|.+|       .+.|.+...|..|+.-.+   
T Consensus        77 ~~~~~cqvagc~~~~d~lD~~E~hY~~~h-------------~~---sCs~C-------~r~~Pt~hLLd~HI~E~HDs~  133 (253)
T KOG4173|consen   77 VPAFACQVAGCCQVFDALDDYEHHYHTLH-------------GN---SCSFC-------KRAFPTGHLLDAHILEWHDSL  133 (253)
T ss_pred             cccccccccchHHHHhhhhhHHHhhhhcc-------------cc---hhHHH-------HHhCCchhhhhHHHHHHHHHH
Confidence            45678876  8888888887777765543             22   68888       999999999999976432   


Q ss_pred             -------CCceeec--ccccccccchhhHHHHHHH-h
Q 026267          137 -------GEKKYKC--ERCSKKYAVQSDWKAHMKT-C  163 (241)
Q Consensus       137 -------~ek~~~C--~~C~k~f~~~~~L~~H~~~-~  163 (241)
                             |.-.|.|  ..|+..|.+...-+.|+.. |
T Consensus       134 Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  134 FQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             HHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence                   5567999  4599999999999999987 6


No 73 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=87.24  E-value=0.98  Score=31.23  Aligned_cols=24  Identities=21%  Similarity=0.588  Sum_probs=22.2

Q ss_pred             eec----ccccccccchhhHHHHHHH-hC
Q 026267          141 YKC----ERCSKKYAVQSDWKAHMKT-CG  164 (241)
Q Consensus       141 ~~C----~~C~k~f~~~~~L~~H~~~-~~  164 (241)
                      |.|    ..|+..+.+...+..|++. ||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    9999999999999999998 64


No 74 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.01  E-value=0.55  Score=32.44  Aligned_cols=29  Identities=28%  Similarity=0.634  Sum_probs=16.6

Q ss_pred             eecccccccccchhhHHHHHHHhCCcceecC-CCCCcCCc
Q 026267          141 YKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSRR  179 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~~  179 (241)
                      ..|..||++|.-.          +..|-.|. ||..|.-.
T Consensus        10 R~Cp~CG~kFYDL----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC----------CCCCccCCCCCCccCcc
Confidence            4566666666553          22556666 66666544


No 75 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=82.77  E-value=0.82  Score=29.93  Aligned_cols=35  Identities=29%  Similarity=0.574  Sum_probs=22.8

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccch
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQ  153 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~  153 (241)
                      ....|.|+.|       ++.        .+.+.-+|  -|.|..||..|.--
T Consensus        32 ~~~~~~Cp~C-------~~~--------~VkR~a~G--IW~C~kCg~~fAGg   66 (89)
T COG1997          32 QRAKHVCPFC-------GRT--------TVKRIATG--IWKCRKCGAKFAGG   66 (89)
T ss_pred             HhcCCcCCCC-------CCc--------ceeeeccC--eEEcCCCCCeeccc
Confidence            3457889988       542        23444444  48899998888644


No 76 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=82.65  E-value=0.82  Score=32.80  Aligned_cols=19  Identities=26%  Similarity=0.490  Sum_probs=7.1

Q ss_pred             CCCCcCCcchHHHHHHhccCch
Q 026267          172 CGTIFSRRDSFITHRAFCDALA  193 (241)
Q Consensus       172 C~k~f~~~~~L~~H~~~~~~~~  193 (241)
                      ||+.|..   |++|++.||++.
T Consensus        78 cGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   78 CGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             T--EESB---HHHHHHHTT-S-
T ss_pred             CCcccch---HHHHHHHccCCC
Confidence            4444432   355555555443


No 77 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=81.54  E-value=0.83  Score=24.13  Aligned_cols=10  Identities=20%  Similarity=0.730  Sum_probs=6.9

Q ss_pred             ceeecccccc
Q 026267          139 KKYKCERCSK  148 (241)
Q Consensus       139 k~~~C~~C~k  148 (241)
                      .++.|.+||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            5677777764


No 78 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=81.24  E-value=1.7  Score=24.53  Aligned_cols=25  Identities=40%  Similarity=0.658  Sum_probs=12.2

Q ss_pred             CCceeecccccccccch----hhHHHHHH
Q 026267          137 GEKKYKCERCSKKYAVQ----SDWKAHMK  161 (241)
Q Consensus       137 ~ek~~~C~~C~k~f~~~----~~L~~H~~  161 (241)
                      +.....|..|++.+...    +.|.+|++
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            34556777777766653    55555553


No 79 
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=80.84  E-value=4.1  Score=35.05  Aligned_cols=13  Identities=0%  Similarity=-0.335  Sum_probs=9.7

Q ss_pred             chHHHHHHhccCc
Q 026267          180 DSFITHRAFCDAL  192 (241)
Q Consensus       180 ~~L~~H~~~~~~~  192 (241)
                      ..|+.-.+.||..
T Consensus       197 ~eL~~YVk~hhtT  209 (480)
T KOG2675|consen  197 LELQAYVKEHHTT  209 (480)
T ss_pred             HHHHHHHHHhccc
Confidence            3588888888764


No 80 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=80.68  E-value=0.85  Score=35.63  Aligned_cols=30  Identities=20%  Similarity=0.423  Sum_probs=22.5

Q ss_pred             CCceeecccccccccchhhHHHHHHH-hCCc
Q 026267          137 GEKKYKCERCSKKYAVQSDWKAHMKT-CGTR  166 (241)
Q Consensus       137 ~ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k  166 (241)
                      .+..|.|..|+|.|.-......|+.. |.++
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            45679999999999999999999988 7553


No 81 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=78.27  E-value=0.49  Score=37.09  Aligned_cols=12  Identities=25%  Similarity=0.675  Sum_probs=7.3

Q ss_pred             eecC-CCCCcCCc
Q 026267          168 YKCD-CGTIFSRR  179 (241)
Q Consensus       168 ~~C~-C~k~f~~~  179 (241)
                      ..|+ ||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            3577 77766543


No 82 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=78.03  E-value=1.7  Score=25.35  Aligned_cols=14  Identities=36%  Similarity=0.766  Sum_probs=8.2

Q ss_pred             eeecccccccccch
Q 026267          140 KYKCERCSKKYAVQ  153 (241)
Q Consensus       140 ~~~C~~C~k~f~~~  153 (241)
                      .-.|..|++.+...
T Consensus        18 ~a~C~~C~~~l~~~   31 (50)
T smart00614       18 RAKCKYCGKKLSRS   31 (50)
T ss_pred             EEEecCCCCEeeeC
Confidence            34566666666544


No 83 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=76.93  E-value=2.4  Score=38.86  Aligned_cols=27  Identities=30%  Similarity=0.518  Sum_probs=24.8

Q ss_pred             CCCccccccccccCChhHHHHHhhhcC
Q 026267           62 TNRFVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      ...|.|.+|+|.|.....+..||+.|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            456999999999999999999999996


No 84 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=76.46  E-value=2.3  Score=30.50  Aligned_cols=27  Identities=30%  Similarity=0.615  Sum_probs=17.3

Q ss_pred             CCCCCccccccccccCChhHHHHHhhhcCC
Q 026267           60 LATNRFVCEICNKGFQRDQNLQLHRRGHNL   89 (241)
Q Consensus        60 ~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~   89 (241)
                      ....-..|-+||+.|..   |++|++.|++
T Consensus        68 I~~d~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   68 ITPDYIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             B-SS-EE-TBT--EESB---HHHHHHHTT-
T ss_pred             cccCeeEEccCCcccch---HHHHHHHccC
Confidence            34566789999999966   6999999974


No 85 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=75.21  E-value=2.7  Score=22.70  Aligned_cols=12  Identities=33%  Similarity=1.046  Sum_probs=5.8

Q ss_pred             ecccccccccch
Q 026267          142 KCERCSKKYAVQ  153 (241)
Q Consensus       142 ~C~~C~k~f~~~  153 (241)
                      .|+.|+..|.-.
T Consensus         4 ~Cp~C~~~y~i~   15 (36)
T PF13717_consen    4 TCPNCQAKYEID   15 (36)
T ss_pred             ECCCCCCEEeCC
Confidence            445555554444


No 86 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.01  E-value=1.9  Score=30.46  Aligned_cols=29  Identities=17%  Similarity=0.230  Sum_probs=16.4

Q ss_pred             eecccccccccchhhHHHHHHHhCCcceecC-CCCCcCCc
Q 026267          141 YKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSRR  179 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~~  179 (241)
                      +.|..||++|...          +..|..|. ||..|.-.
T Consensus        10 r~Cp~cg~kFYDL----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc----------CCCCccCCCcCCccCcc
Confidence            4566666666543          23556666 66666444


No 87 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=74.76  E-value=2.2  Score=22.71  Aligned_cols=10  Identities=30%  Similarity=0.654  Sum_probs=5.7

Q ss_pred             ceeecccccc
Q 026267          139 KKYKCERCSK  148 (241)
Q Consensus       139 k~~~C~~C~k  148 (241)
                      .|..|.+||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            3456666654


No 88 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=73.19  E-value=3.2  Score=30.43  Aligned_cols=36  Identities=25%  Similarity=0.588  Sum_probs=18.8

Q ss_pred             CceeecccccccccchhhHHHHHHHhCCcceecC-CCCCc
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIF  176 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f  176 (241)
                      ..-|.|+.|+..|.....+..   .....-|.|+ ||...
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~---~d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL---LDMDGTFTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh---cCCCCcEECCCCCCEE
Confidence            345777777777665433221   0112337777 77553


No 89 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=72.71  E-value=3.7  Score=28.47  Aligned_cols=80  Identities=15%  Similarity=0.251  Sum_probs=48.4

Q ss_pred             CccccCCCCCcccCCCCCcCCChhhHhhhhcccc-----CC-------ceeecccccccccchhhHHHHHHHhCCcceec
Q 026267          103 KKVYVCPESTCVHHNPARALGDLTGIKKHFSRKH-----GE-------KKYKCERCSKKYAVQSDWKAHMKTCGTREYKC  170 (241)
Q Consensus       103 ~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~-----~e-------k~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C  170 (241)
                      +-|-.|+.|       +-..-...+|.+-...--     .|       ....|-.|.+.|........- .......|.|
T Consensus        13 ~LP~~CpiC-------gLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~-~~~~~~~y~C   84 (112)
T TIGR00622        13 ELPVECPIC-------GLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD-ELKDSHRYVC   84 (112)
T ss_pred             CCCCcCCcC-------CCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccccc-ccccccceeC
Confidence            345678888       666655555554321100     01       112488999999865321100 0123457999


Q ss_pred             C-CCCCcCCcchHHHHHHhcc
Q 026267          171 D-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       171 ~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      . |...|-..-+.-.|...|.
T Consensus        85 ~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        85 AVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             CCCCCccccccchhhhhhccC
Confidence            9 9999999888888887764


No 90 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=72.47  E-value=1.8  Score=31.99  Aligned_cols=17  Identities=18%  Similarity=0.558  Sum_probs=11.6

Q ss_pred             eeecccccccccchhhH
Q 026267          140 KYKCERCSKKYAVQSDW  156 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L  156 (241)
                      .+.|..||++|..-..+
T Consensus        28 ~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         28 RRECLACGKRFTTFERV   44 (154)
T ss_pred             eeeccccCCcceEeEec
Confidence            37788888887765443


No 91 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=71.36  E-value=4.1  Score=30.28  Aligned_cols=31  Identities=13%  Similarity=0.577  Sum_probs=19.7

Q ss_pred             CCceeecccccccccchhhHHHHHHHhCCcceecC-CCCC
Q 026267          137 GEKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTI  175 (241)
Q Consensus       137 ~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~  175 (241)
                      +..-|.|+.|+..|..-..+.        .-|.|+ ||..
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~  137 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME--------LNFTCPRCGAM  137 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH--------cCCcCCCCCCE
Confidence            344577777777777666654        257777 7755


No 92 
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=69.59  E-value=1.5  Score=40.00  Aligned_cols=24  Identities=33%  Similarity=0.614  Sum_probs=21.9

Q ss_pred             eeecccccccccchhhHHHHHHHh
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKTC  163 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~~  163 (241)
                      -|.|..|+|.|.....+..||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            499999999999999999999886


No 93 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=68.85  E-value=4.9  Score=30.55  Aligned_cols=33  Identities=15%  Similarity=0.678  Sum_probs=22.6

Q ss_pred             CceeecccccccccchhhHHHHHHHhCCcceecC-CCCCcCC
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSR  178 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~  178 (241)
                      ..-|.|+.|+..|..-..+.        .-|.|+ ||.....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME--------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh--------cCCcCCCCCCCCee
Confidence            34578888888887776653        358888 8866443


No 94 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=68.55  E-value=2.3  Score=30.24  Aligned_cols=15  Identities=20%  Similarity=0.596  Sum_probs=13.1

Q ss_pred             CccccccccccCChh
Q 026267           64 RFVCEICNKGFQRDQ   78 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~   78 (241)
                      |++|..||+.|.+-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            579999999998865


No 95 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=68.54  E-value=4.2  Score=20.16  Aligned_cols=20  Identities=15%  Similarity=0.459  Sum_probs=15.9

Q ss_pred             ccccccccccCChhHHHHHhh
Q 026267           65 FVCEICNKGFQRDQNLQLHRR   85 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~L~~H~~   85 (241)
                      ..|+.|++.+ ....+..|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3699999998 6677888865


No 96 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=68.34  E-value=3  Score=24.25  Aligned_cols=11  Identities=45%  Similarity=1.304  Sum_probs=6.0

Q ss_pred             eeecccccccc
Q 026267          140 KYKCERCSKKY  150 (241)
Q Consensus       140 ~~~C~~C~k~f  150 (241)
                      .|+|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            35555555555


No 97 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=67.97  E-value=3.8  Score=28.35  Aligned_cols=32  Identities=19%  Similarity=0.558  Sum_probs=24.1

Q ss_pred             ccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccch
Q 026267          104 KVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQ  153 (241)
Q Consensus       104 ~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~  153 (241)
                      ....|+.|       |..|-..           +..|..|.+||..|.-.
T Consensus         8 tKR~Cp~C-------G~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    8 TKRTCPSC-------GAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CcccCCCC-------cchhccC-----------CCCCccCCCCCCccCcc
Confidence            34589999       7777432           24688999999999876


No 98 
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=67.44  E-value=2.9  Score=30.55  Aligned_cols=33  Identities=30%  Similarity=0.836  Sum_probs=22.6

Q ss_pred             CceeecccccccccchhhHHHHHHH-hCCcceecC-CCCC
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CGTI  175 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~k~  175 (241)
                      .-+|.|. |+..|.+.   .+|-.. -|+ .|.|. |+-.
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            3468998 99887665   344444 465 89998 8754


No 99 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=65.93  E-value=3.7  Score=30.73  Aligned_cols=25  Identities=36%  Similarity=0.744  Sum_probs=18.4

Q ss_pred             ccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccc
Q 026267          104 KVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSK  148 (241)
Q Consensus       104 ~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k  148 (241)
                      +.|.|++|       |.             ++-|+-|.+|++||.
T Consensus       133 ~~~vC~vC-------Gy-------------~~~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVC-------GY-------------THEGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCC-------CC-------------cccCCCCCcCCCCCC
Confidence            37888888       54             345678888888884


No 100
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=65.50  E-value=4.9  Score=22.71  Aligned_cols=22  Identities=36%  Similarity=0.569  Sum_probs=18.6

Q ss_pred             eecccccccccchhhHHHHHHH
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      |+|-+|..+...++.|-.||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            6788888888888888888875


No 101
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=65.47  E-value=5.1  Score=22.73  Aligned_cols=12  Identities=17%  Similarity=0.681  Sum_probs=6.7

Q ss_pred             ceeecccccccc
Q 026267          139 KKYKCERCSKKY  150 (241)
Q Consensus       139 k~~~C~~C~k~f  150 (241)
                      .+.+|..||...
T Consensus        18 ~~irC~~CG~rI   29 (44)
T smart00659       18 DVVRCRECGYRI   29 (44)
T ss_pred             CceECCCCCceE
Confidence            346666666543


No 102
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=64.86  E-value=2.8  Score=32.90  Aligned_cols=44  Identities=14%  Similarity=0.256  Sum_probs=28.7

Q ss_pred             CccccCCCCCcccCCCCCcCCChhhHhhhhccc---c-------CCc-----eeecccccccccch
Q 026267          103 KKVYVCPESTCVHHNPARALGDLTGIKKHFSRK---H-------GEK-----KYKCERCSKKYAVQ  153 (241)
Q Consensus       103 ~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h---~-------~ek-----~~~C~~C~k~f~~~  153 (241)
                      .+.+.|++|       +..|....-.....+.-   +       +..     .+.|+.||.+|...
T Consensus         3 ~k~~~CPvC-------~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVC-------GKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCC-------CCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            356789999       88887765444444321   1       122     35899999987754


No 103
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=64.71  E-value=3.8  Score=29.24  Aligned_cols=24  Identities=25%  Similarity=0.296  Sum_probs=12.7

Q ss_pred             ecC-CCCCcCCcchHHHHHHhccCchhh
Q 026267          169 KCD-CGTIFSRRDSFITHRAFCDALAEE  195 (241)
Q Consensus       169 ~C~-C~k~f~~~~~L~~H~~~~~~~~~~  195 (241)
                      .|- +||.|.   +|++|+.+|+++..+
T Consensus        78 icLEDGkkfK---SLKRHL~t~~gmTPd  102 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHYGLTPD  102 (148)
T ss_pred             EEeccCcchH---HHHHHHhcccCCCHH
Confidence            354 555553   356666666655433


No 104
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=64.30  E-value=3.4  Score=22.36  Aligned_cols=15  Identities=20%  Similarity=0.576  Sum_probs=11.8

Q ss_pred             ccccccccccCChhH
Q 026267           65 FVCEICNKGFQRDQN   79 (241)
Q Consensus        65 ~~C~~C~~~f~~~~~   79 (241)
                      +.|+.|+..|.-...
T Consensus         3 ~~CP~C~~~~~v~~~   17 (38)
T TIGR02098         3 IQCPNCKTSFRVVDS   17 (38)
T ss_pred             EECCCCCCEEEeCHH
Confidence            579999998876654


No 105
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=63.63  E-value=5.9  Score=20.78  Aligned_cols=11  Identities=18%  Similarity=0.827  Sum_probs=5.5

Q ss_pred             eeecccccccc
Q 026267          140 KYKCERCSKKY  150 (241)
Q Consensus       140 ~~~C~~C~k~f  150 (241)
                      +.+|..||...
T Consensus        17 ~irC~~CG~RI   27 (32)
T PF03604_consen   17 PIRCPECGHRI   27 (32)
T ss_dssp             TSSBSSSS-SE
T ss_pred             cEECCcCCCeE
Confidence            35666666543


No 106
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=63.16  E-value=3.5  Score=26.17  Aligned_cols=39  Identities=15%  Similarity=0.421  Sum_probs=18.5

Q ss_pred             eecccccccccchhhHHHHHHHhCCcceecC---CCCCcCCcc
Q 026267          141 YKCERCSKKYAVQSDWKAHMKTCGTREYKCD---CGTIFSRRD  180 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~---C~k~f~~~~  180 (241)
                      +.|..||..-.-...-..+.. ..++-|.|.   ||.+|....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~-~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT-TKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh-hheeeeecCCCCCCCEEEEEE
Confidence            456666654322222111111 234566773   777776654


No 107
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=62.68  E-value=5.4  Score=29.22  Aligned_cols=40  Identities=18%  Similarity=0.473  Sum_probs=27.1

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccc
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAV  152 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~  152 (241)
                      ....|.|+.|       +..|.....+.. .  .. ...|.|+.||.....
T Consensus        96 ~~~~Y~Cp~C-------~~~y~~~ea~~~-~--d~-~~~f~Cp~Cg~~l~~  135 (147)
T smart00531       96 NNAYYKCPNC-------QSKYTFLEANQL-L--DM-DGTFTCPRCGEELEE  135 (147)
T ss_pred             CCcEEECcCC-------CCEeeHHHHHHh-c--CC-CCcEECCCCCCEEEE
Confidence            5678999999       888876544332 1  11 334999999987643


No 108
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=62.55  E-value=6.8  Score=35.14  Aligned_cols=28  Identities=18%  Similarity=0.347  Sum_probs=24.1

Q ss_pred             CCCCccccccccccCChhHHHHHhhhcC
Q 026267           61 ATNRFVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        61 ~~~~~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      ...+-.|..||..|.+......||..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3457889999999999999988888885


No 109
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=61.35  E-value=7.6  Score=20.99  Aligned_cols=11  Identities=27%  Similarity=1.041  Sum_probs=5.7

Q ss_pred             eeecccccccc
Q 026267          140 KYKCERCSKKY  150 (241)
Q Consensus       140 ~~~C~~C~k~f  150 (241)
                      ..+|..|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            45555555544


No 110
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=60.82  E-value=5.5  Score=31.72  Aligned_cols=48  Identities=23%  Similarity=0.542  Sum_probs=36.4

Q ss_pred             cccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccchhhHHHHHHH
Q 026267          105 VYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       105 ~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      .|.|..|       +.... ...+.+|+-.=++ .-|.|-.|++.|.+ .....|..-
T Consensus         3 ~FtCnvC-------gEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVC-------GESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhh-------hhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            4789999       66554 3456778877666 67999999999999 666778653


No 111
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=60.22  E-value=9.9  Score=23.01  Aligned_cols=9  Identities=44%  Similarity=1.272  Sum_probs=5.9

Q ss_pred             cceecC-CCC
Q 026267          166 REYKCD-CGT  174 (241)
Q Consensus       166 k~~~C~-C~k  174 (241)
                      .+|.|. ||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            567776 764


No 112
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=59.70  E-value=7.9  Score=33.35  Aligned_cols=34  Identities=32%  Similarity=0.746  Sum_probs=21.4

Q ss_pred             CCceeecccccccccchhhHHHHHHH-hCCcceecC-CC
Q 026267          137 GEKKYKCERCSKKYAVQSDWKAHMKT-CGTREYKCD-CG  173 (241)
Q Consensus       137 ~ek~~~C~~C~k~f~~~~~L~~H~~~-~~~k~~~C~-C~  173 (241)
                      ...-|.|..|.+.|.....+.   .. -..-.|.|. |+
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCG  160 (436)
T ss_pred             ccccccCCccccchhhhHHHH---hhcccCceEEEecCC
Confidence            345688888888877765543   22 223567887 76


No 113
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=58.93  E-value=5.7  Score=31.10  Aligned_cols=30  Identities=17%  Similarity=0.393  Sum_probs=23.0

Q ss_pred             CCcceecC-CCCCcCCcchHHHHHHhccCch
Q 026267          164 GTREYKCD-CGTIFSRRDSFITHRAFCDALA  193 (241)
Q Consensus       164 ~~k~~~C~-C~k~f~~~~~L~~H~~~~~~~~  193 (241)
                      .+..|.|. |+|.|.-..-.++|+...|...
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            45679999 9999999999999999877643


No 114
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=58.53  E-value=9.4  Score=23.11  Aligned_cols=31  Identities=23%  Similarity=0.368  Sum_probs=19.1

Q ss_pred             CCccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCC
Q 026267           63 NRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPES  111 (241)
Q Consensus        63 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C  111 (241)
                      -.|.|+.||+.--....--   |.               ...+|.|+.|
T Consensus        26 v~F~CPnCGe~~I~Rc~~C---Rk---------------~g~~Y~Cp~C   56 (61)
T COG2888          26 VKFPCPNCGEVEIYRCAKC---RK---------------LGNPYRCPKC   56 (61)
T ss_pred             eEeeCCCCCceeeehhhhH---HH---------------cCCceECCCc
Confidence            3688999996543333211   11               3478899888


No 115
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=58.38  E-value=9.1  Score=28.43  Aligned_cols=35  Identities=14%  Similarity=0.480  Sum_probs=27.1

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccc
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAV  152 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~  152 (241)
                      ...-|.|+.|       +..|+....+.         .-|.|+.||.....
T Consensus       106 ~~~~Y~Cp~c-------~~r~tf~eA~~---------~~F~Cp~Cg~~L~~  140 (158)
T TIGR00373       106 NNMFFICPNM-------CVRFTFNEAME---------LNFTCPRCGAMLDY  140 (158)
T ss_pred             CCCeEECCCC-------CcEeeHHHHHH---------cCCcCCCCCCEeee
Confidence            5678999999       88887777664         25999999976543


No 116
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=57.50  E-value=21  Score=24.85  Aligned_cols=89  Identities=17%  Similarity=0.239  Sum_probs=51.2

Q ss_pred             CCccccccccccCChhHHHHHhhhcCC-C-chhhhcchhhhcCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCce
Q 026267           63 NRFVCEICNKGFQRDQNLQLHRRGHNL-P-WKLKQRNSKEVRKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKK  140 (241)
Q Consensus        63 ~~~~C~~C~~~f~~~~~L~~H~~~h~~-~-~~~~~~~~~~~~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~  140 (241)
                      -|..|+.||-..-....|.+-  .|+. + ..+... ..........|--|       ...|........-  .-.....
T Consensus        14 LP~~CpiCgLtLVss~HLARS--yHHLfPl~~f~ev-~~~~~~~~~~C~~C-------~~~f~~~~~~~~~--~~~~~~~   81 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARS--YHHLFPLKAFQEI-PLEEYNGSRFCFGC-------QGPFPKPPVSPFD--ELKDSHR   81 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHh--hhccCCCcccccc-cccccCCCCcccCc-------CCCCCCccccccc--ccccccc
Confidence            467899999999888888754  2331 1 111110 00001112247666       6666543211100  0122446


Q ss_pred             eecccccccccchhhHHHHHHHh
Q 026267          141 YKCERCSKKYAVQSDWKAHMKTC  163 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~~  163 (241)
                      |.|..|...|-..-++-.|...|
T Consensus        82 y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        82 YVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             eeCCCCCCccccccchhhhhhcc
Confidence            99999999999888888887665


No 117
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=57.25  E-value=4.9  Score=26.68  Aligned_cols=32  Identities=31%  Similarity=0.663  Sum_probs=18.8

Q ss_pred             ccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccc
Q 026267          104 KVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAV  152 (241)
Q Consensus       104 ~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~  152 (241)
                      ..|.|++|       ++.-        -.+.-.|.  |.|..|++.|.-
T Consensus        34 ~ky~Cp~C-------gk~~--------vkR~a~GI--W~C~~C~~~~AG   65 (90)
T PF01780_consen   34 AKYTCPFC-------GKTS--------VKRVATGI--WKCKKCGKKFAG   65 (90)
T ss_dssp             S-BEESSS-------SSSE--------EEEEETTE--EEETTTTEEEE-
T ss_pred             CCCcCCCC-------CCce--------eEEeeeEE--eecCCCCCEEeC
Confidence            56888888       4421        12233443  888888888763


No 118
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=57.11  E-value=7.4  Score=27.26  Aligned_cols=24  Identities=25%  Similarity=0.600  Sum_probs=19.5

Q ss_pred             ceeecccccccccchhhHHHHHHH
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      -.|.|-.|.+-|.....|..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            457888888888888888888876


No 119
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=57.05  E-value=5  Score=19.92  Aligned_cols=11  Identities=27%  Similarity=0.733  Sum_probs=9.0

Q ss_pred             ccccccccccC
Q 026267           65 FVCEICNKGFQ   75 (241)
Q Consensus        65 ~~C~~C~~~f~   75 (241)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            36999999885


No 120
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=56.94  E-value=6.1  Score=27.64  Aligned_cols=26  Identities=23%  Similarity=0.482  Sum_probs=23.2

Q ss_pred             CCCCccccccccccCChhHHHHHhhh
Q 026267           61 ATNRFVCEICNKGFQRDQNLQLHRRG   86 (241)
Q Consensus        61 ~~~~~~C~~C~~~f~~~~~L~~H~~~   86 (241)
                      +...|-|-+|.+-|.+...|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            45679999999999999999999875


No 121
>PF14353 CpXC:  CpXC protein
Probab=55.85  E-value=11  Score=26.78  Aligned_cols=18  Identities=17%  Similarity=0.595  Sum_probs=9.3

Q ss_pred             eecccccccccchhhHHH
Q 026267          141 YKCERCSKKYAVQSDWKA  158 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~  158 (241)
                      |.|+.||..|.-...+..
T Consensus        39 ~~CP~Cg~~~~~~~p~lY   56 (128)
T PF14353_consen   39 FTCPSCGHKFRLEYPLLY   56 (128)
T ss_pred             EECCCCCCceecCCCEEE
Confidence            555555555554444433


No 122
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=55.49  E-value=6.3  Score=29.94  Aligned_cols=35  Identities=11%  Similarity=0.427  Sum_probs=26.3

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeecccccccccc
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKKYAV  152 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~f~~  152 (241)
                      ...-|.|+.|       +..|+....+.         .-|.|+.||.....
T Consensus       114 ~~~~Y~Cp~C-------~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNC-------HIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCC-------CcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            4578999999       78887766543         35999999976543


No 123
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=54.96  E-value=14  Score=31.28  Aligned_cols=51  Identities=22%  Similarity=0.365  Sum_probs=43.1

Q ss_pred             cccCCCCCcccCCCCCcCCChhhHhhhhccccCC-----------------------ceeeccccc---ccccchhhHHH
Q 026267          105 VYVCPESTCVHHNPARALGDLTGIKKHFSRKHGE-----------------------KKYKCERCS---KKYAVQSDWKA  158 (241)
Q Consensus       105 ~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~e-----------------------k~~~C~~C~---k~f~~~~~L~~  158 (241)
                      |-.|-.|       +..+.....-..||..++|-                       .-|.|..|.   +.|.+......
T Consensus       166 Pt~CLfC-------~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~  238 (390)
T KOG2785|consen  166 PTDCLFC-------DKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRA  238 (390)
T ss_pred             Ccceeec-------CCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHH
Confidence            4578888       88899999999999988852                       237899998   99999999999


Q ss_pred             HHHH
Q 026267          159 HMKT  162 (241)
Q Consensus       159 H~~~  162 (241)
                      ||..
T Consensus       239 HM~~  242 (390)
T KOG2785|consen  239 HMRD  242 (390)
T ss_pred             HHhh
Confidence            9997


No 124
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=54.36  E-value=7.2  Score=33.69  Aligned_cols=29  Identities=28%  Similarity=0.736  Sum_probs=22.4

Q ss_pred             ecccccccccchhhHHHHHHHhCCcceecC-CCCCcCCcc
Q 026267          142 KCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSRRD  180 (241)
Q Consensus       142 ~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~~~  180 (241)
                      .|..||.+..+          .|.+-|+|. |++.+....
T Consensus       352 ~Cp~Cg~~m~S----------~G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKS----------AGRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhh----------cCCCCcccccccccCCccc
Confidence            69999977444          355589999 999988764


No 125
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]
Probab=52.20  E-value=31  Score=32.43  Aligned_cols=11  Identities=0%  Similarity=0.042  Sum_probs=4.6

Q ss_pred             cccccccccch
Q 026267          143 CERCSKKYAVQ  153 (241)
Q Consensus       143 C~~C~k~f~~~  153 (241)
                      |..|+-.|.++
T Consensus       439 r~~~DPdf~yr  449 (1102)
T KOG1924|consen  439 RTGMDPDFKYR  449 (1102)
T ss_pred             cCCCCCCcchh
Confidence            34444444443


No 126
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=52.02  E-value=4.5  Score=23.61  Aligned_cols=9  Identities=22%  Similarity=0.667  Sum_probs=5.0

Q ss_pred             eeecccccc
Q 026267          140 KYKCERCSK  148 (241)
Q Consensus       140 ~~~C~~C~k  148 (241)
                      ...|..||.
T Consensus        26 ~~~CP~Cg~   34 (52)
T TIGR02605        26 LATCPECGG   34 (52)
T ss_pred             CCCCCCCCC
Confidence            345666664


No 127
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=52.01  E-value=7.8  Score=25.78  Aligned_cols=14  Identities=29%  Similarity=0.823  Sum_probs=10.2

Q ss_pred             eeecccccccccch
Q 026267          140 KYKCERCSKKYAVQ  153 (241)
Q Consensus       140 ~~~C~~C~k~f~~~  153 (241)
                      .|.|..|++.|.--
T Consensus        53 IW~C~~C~~~~AGG   66 (91)
T TIGR00280        53 IWTCRKCGAKFAGG   66 (91)
T ss_pred             EEEcCCCCCEEeCC
Confidence            48888888877643


No 128
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=50.45  E-value=6.2  Score=21.54  Aligned_cols=15  Identities=33%  Similarity=0.702  Sum_probs=11.9

Q ss_pred             CccccccccccCChh
Q 026267           64 RFVCEICNKGFQRDQ   78 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~   78 (241)
                      .|+|..||..|....
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            489999999986544


No 129
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=50.35  E-value=5.2  Score=28.87  Aligned_cols=22  Identities=32%  Similarity=0.689  Sum_probs=16.2

Q ss_pred             ceecC-CCCCcCCcchHHHHHHh
Q 026267          167 EYKCD-CGTIFSRRDSFITHRAF  188 (241)
Q Consensus       167 ~~~C~-C~k~f~~~~~L~~H~~~  188 (241)
                      .|.|. ||-.+....-|..|..+
T Consensus       129 ~ysC~~CG~kyCsv~C~~~HneT  151 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNET  151 (156)
T ss_pred             hhHHHhcCCceeechhhhhcccc
Confidence            46787 88888887777777653


No 130
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=49.95  E-value=13  Score=21.14  Aligned_cols=12  Identities=17%  Similarity=0.564  Sum_probs=6.7

Q ss_pred             eeeccccccccc
Q 026267          140 KYKCERCSKKYA  151 (241)
Q Consensus       140 ~~~C~~C~k~f~  151 (241)
                      .+.|..||..+.
T Consensus        21 ~~~Cp~CG~~~~   32 (46)
T PRK00398         21 GVRCPYCGYRIL   32 (46)
T ss_pred             ceECCCCCCeEE
Confidence            456666665443


No 131
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=49.10  E-value=8.5  Score=21.46  Aligned_cols=10  Identities=20%  Similarity=0.720  Sum_probs=5.7

Q ss_pred             ceeecccccc
Q 026267          139 KKYKCERCSK  148 (241)
Q Consensus       139 k~~~C~~C~k  148 (241)
                      ....|..||.
T Consensus        25 ~~~~CP~Cg~   34 (42)
T PF09723_consen   25 DPVPCPECGS   34 (42)
T ss_pred             CCCcCCCCCC
Confidence            4456666664


No 132
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=48.23  E-value=11  Score=20.68  Aligned_cols=22  Identities=23%  Similarity=0.475  Sum_probs=12.6

Q ss_pred             hhhhccccCCceeecccccccc
Q 026267          129 KKHFSRKHGEKKYKCERCSKKY  150 (241)
Q Consensus       129 ~~H~~~h~~ek~~~C~~C~k~f  150 (241)
                      .-......+.+.|.|..|+..-
T Consensus        13 Np~~~~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen   13 NPFCQFDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             -TTSEEETTTTEEEETTT--EE
T ss_pred             CCcceEcCCCCEEECcCCCCcC
Confidence            3344555566778999988653


No 133
>PHA00626 hypothetical protein
Probab=48.03  E-value=9  Score=22.86  Aligned_cols=14  Identities=36%  Similarity=0.721  Sum_probs=10.4

Q ss_pred             cceecC-CCCCcCCc
Q 026267          166 REYKCD-CGTIFSRR  179 (241)
Q Consensus       166 k~~~C~-C~k~f~~~  179 (241)
                      ..|.|. ||+.|...
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            568888 88888653


No 134
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=47.92  E-value=3.7  Score=34.26  Aligned_cols=28  Identities=7%  Similarity=-0.213  Sum_probs=20.8

Q ss_pred             cCCCCCccccccccccCChhHHHHH-hhhc
Q 026267           59 LLATNRFVCEICNKGFQRDQNLQLH-RRGH   87 (241)
Q Consensus        59 ~~~~~~~~C~~C~~~f~~~~~L~~H-~~~h   87 (241)
                      .+..++|+| .|++.+.+...|+.| +..|
T Consensus       208 ~t~~~p~k~-~~~~~~~T~~~l~~HS~N~~  236 (442)
T KOG4124|consen  208 ETTGTPKKM-PESLVMDTSSPLSDHSMNID  236 (442)
T ss_pred             ccccCCccC-cccccccccchhhhccccCC
Confidence            344568888 589999999988888 3434


No 135
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=47.77  E-value=29  Score=24.87  Aligned_cols=24  Identities=25%  Similarity=0.351  Sum_probs=19.9

Q ss_pred             CCccccccccccCChhHHHHHhhhcCC
Q 026267           63 NRFVCEICNKGFQRDQNLQLHRRGHNL   89 (241)
Q Consensus        63 ~~~~C~~C~~~f~~~~~L~~H~~~h~~   89 (241)
                      .-..|-++|+.|.   .|++|+.+|.+
T Consensus        75 D~IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          75 DYIICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             CeEEEeccCcchH---HHHHHHhcccC
Confidence            4567999999995   59999999873


No 136
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=47.55  E-value=8.4  Score=23.04  Aligned_cols=27  Identities=11%  Similarity=0.413  Sum_probs=12.6

Q ss_pred             hhHhhhhccccCCceeeccc----ccccccc
Q 026267          126 TGIKKHFSRKHGEKKYKCER----CSKKYAV  152 (241)
Q Consensus       126 ~~l~~H~~~h~~ek~~~C~~----C~k~f~~  152 (241)
                      ..|..|....-..++..|..    |...+..
T Consensus        24 ~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen   24 KELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             CCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             HHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            34555555444455555655    5555444


No 137
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=46.94  E-value=8.3  Score=20.80  Aligned_cols=14  Identities=14%  Similarity=0.451  Sum_probs=7.1

Q ss_pred             ceeecccccccccc
Q 026267          139 KKYKCERCSKKYAV  152 (241)
Q Consensus       139 k~~~C~~C~k~f~~  152 (241)
                      ..-.|..||-.+.+
T Consensus        20 ~~~~Cd~cg~~L~q   33 (36)
T PF05191_consen   20 VEGVCDNCGGELVQ   33 (36)
T ss_dssp             STTBCTTTTEBEBE
T ss_pred             CCCccCCCCCeeEe
Confidence            33456666654433


No 138
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=46.80  E-value=10  Score=25.16  Aligned_cols=13  Identities=31%  Similarity=0.940  Sum_probs=9.7

Q ss_pred             eeecccccccccc
Q 026267          140 KYKCERCSKKYAV  152 (241)
Q Consensus       140 ~~~C~~C~k~f~~  152 (241)
                      .|.|..|++.|.-
T Consensus        54 IW~C~~C~~~~AG   66 (90)
T PRK03976         54 IWECRKCGAKFAG   66 (90)
T ss_pred             EEEcCCCCCEEeC
Confidence            4788888887764


No 139
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=46.51  E-value=16  Score=20.29  Aligned_cols=25  Identities=20%  Similarity=0.539  Sum_probs=18.2

Q ss_pred             CccccccccccCCh--hHHHHHhhhcC
Q 026267           64 RFVCEICNKGFQRD--QNLQLHRRGHN   88 (241)
Q Consensus        64 ~~~C~~C~~~f~~~--~~L~~H~~~h~   88 (241)
                      .-.|..||..|...  ..-..|.+.|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            35899999998663  55677777663


No 140
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=45.94  E-value=11  Score=22.63  Aligned_cols=10  Identities=50%  Similarity=0.850  Sum_probs=5.4

Q ss_pred             eccccccccc
Q 026267          142 KCERCSKKYA  151 (241)
Q Consensus       142 ~C~~C~k~f~  151 (241)
                      +|-.|++.+.
T Consensus         4 kC~lCdk~~~   13 (56)
T PF09963_consen    4 KCILCDKKEE   13 (56)
T ss_pred             EEEecCCEEE
Confidence            4555665544


No 141
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=44.63  E-value=34  Score=28.50  Aligned_cols=53  Identities=15%  Similarity=0.428  Sum_probs=35.9

Q ss_pred             CceeecccccccccchhhHHHHHHH----------------------------hCCcceecC-CCCCcCCcchHHHHHHh
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKT----------------------------CGTREYKCD-CGTIFSRRDSFITHRAF  188 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~----------------------------~~~k~~~C~-C~k~f~~~~~L~~H~~~  188 (241)
                      .-|..|.+|+-......+|.+-.+.                            .+.-.|.|. |...|.-.-+.-.|-..
T Consensus       288 sLP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHesL  367 (378)
T KOG2807|consen  288 SLPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHESL  367 (378)
T ss_pred             cCCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhhh
Confidence            4567788888887777777653221                            011348888 99999888777778766


Q ss_pred             cc
Q 026267          189 CD  190 (241)
Q Consensus       189 ~~  190 (241)
                      |-
T Consensus       368 h~  369 (378)
T KOG2807|consen  368 HN  369 (378)
T ss_pred             hc
Confidence            64


No 142
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=44.62  E-value=8.8  Score=18.68  Aligned_cols=10  Identities=30%  Similarity=0.630  Sum_probs=8.3

Q ss_pred             CCcccccccc
Q 026267           63 NRFVCEICNK   72 (241)
Q Consensus        63 ~~~~C~~C~~   72 (241)
                      ..|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4799999985


No 143
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=44.16  E-value=11  Score=23.32  Aligned_cols=12  Identities=17%  Similarity=0.772  Sum_probs=3.9

Q ss_pred             ceeecccccccc
Q 026267          139 KKYKCERCSKKY  150 (241)
Q Consensus       139 k~~~C~~C~k~f  150 (241)
                      +.+.|..||..|
T Consensus        24 rrhhCr~CG~~v   35 (69)
T PF01363_consen   24 RRHHCRNCGRVV   35 (69)
T ss_dssp             -EEE-TTT--EE
T ss_pred             eeEccCCCCCEE
Confidence            334555555444


No 144
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=43.97  E-value=18  Score=30.32  Aligned_cols=25  Identities=20%  Similarity=0.744  Sum_probs=20.0

Q ss_pred             CCCCccccc--cccccCChhHHHHHhh
Q 026267           61 ATNRFVCEI--CNKGFQRDQNLQLHRR   85 (241)
Q Consensus        61 ~~~~~~C~~--C~~~f~~~~~L~~H~~   85 (241)
                      -.++|+|.+  |.+.+.....|+.|..
T Consensus       346 ~~~~~~~~vp~~~~~~~n~ng~~~~~~  372 (442)
T KOG4124|consen  346 VDKPYKCPVPNCDKAYKNQNGLKYHKL  372 (442)
T ss_pred             ecCCCCCCCCcchhhcccCcceeeccc
Confidence            457899965  9999998888888754


No 145
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=42.58  E-value=15  Score=24.29  Aligned_cols=15  Identities=20%  Similarity=0.483  Sum_probs=12.2

Q ss_pred             CCCccccccccccCC
Q 026267           62 TNRFVCEICNKGFQR   76 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~   76 (241)
                      .+|-.|..||..|.+
T Consensus        56 v~Pa~CkkCGfef~~   70 (97)
T COG3357          56 VRPARCKKCGFEFRD   70 (97)
T ss_pred             ecChhhcccCccccc
Confidence            357789999999976


No 146
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=42.51  E-value=11  Score=30.29  Aligned_cols=18  Identities=17%  Similarity=0.456  Sum_probs=9.3

Q ss_pred             cceecC-CCCCcCCcchHH
Q 026267          166 REYKCD-CGTIFSRRDSFI  183 (241)
Q Consensus       166 k~~~C~-C~k~f~~~~~L~  183 (241)
                      +++.|. |+........|.
T Consensus       208 k~~PCPKCg~et~eTkdLS  226 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLS  226 (314)
T ss_pred             CCCCCCCCCCcccccccce
Confidence            556666 665544444443


No 147
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=42.49  E-value=11  Score=20.69  Aligned_cols=14  Identities=29%  Similarity=0.681  Sum_probs=12.1

Q ss_pred             CccccccccccCCh
Q 026267           64 RFVCEICNKGFQRD   77 (241)
Q Consensus        64 ~~~C~~C~~~f~~~   77 (241)
                      +|+|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            79999999999654


No 148
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=42.03  E-value=9.1  Score=35.77  Aligned_cols=11  Identities=18%  Similarity=0.377  Sum_probs=5.8

Q ss_pred             cccccccccCC
Q 026267           66 VCEICNKGFQR   76 (241)
Q Consensus        66 ~C~~C~~~f~~   76 (241)
                      .|..||..|..
T Consensus       437 ~C~~Cg~v~~C  447 (730)
T COG1198         437 LCRDCGYIAEC  447 (730)
T ss_pred             ecccCCCcccC
Confidence            36666655533


No 149
>PRK04351 hypothetical protein; Provisional
Probab=41.51  E-value=12  Score=27.44  Aligned_cols=33  Identities=24%  Similarity=0.763  Sum_probs=22.6

Q ss_pred             ceeecccccccccchhhHHHHHHHhCCcceecC-CCCCcCC
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFSR  178 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~~  178 (241)
                      -.|.|..||..+.+.       +.+....|.|. |+-.+..
T Consensus       111 y~Y~C~~Cg~~~~r~-------Rr~n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        111 YLYECQSCGQQYLRK-------RRINTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEEECCCCCCEeeee-------eecCCCcEEeCCCCcEeee
Confidence            358898898776542       22456789998 9876543


No 150
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=41.20  E-value=17  Score=21.23  Aligned_cols=12  Identities=17%  Similarity=0.792  Sum_probs=7.6

Q ss_pred             ceeecccccccc
Q 026267          139 KKYKCERCSKKY  150 (241)
Q Consensus       139 k~~~C~~C~k~f  150 (241)
                      ..|.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            346777777654


No 151
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.03  E-value=9.5  Score=27.53  Aligned_cols=15  Identities=20%  Similarity=0.793  Sum_probs=8.8

Q ss_pred             ceeecccccccccch
Q 026267          139 KKYKCERCSKKYAVQ  153 (241)
Q Consensus       139 k~~~C~~C~k~f~~~  153 (241)
                      ..|.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            346666666666543


No 152
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=40.58  E-value=12  Score=22.24  Aligned_cols=10  Identities=20%  Similarity=0.803  Sum_probs=5.0

Q ss_pred             eecccccccc
Q 026267          141 YKCERCSKKY  150 (241)
Q Consensus       141 ~~C~~C~k~f  150 (241)
                      ..|..||..|
T Consensus        23 V~Cp~CGael   32 (54)
T TIGR01206        23 VICDECGAEL   32 (54)
T ss_pred             EeCCCCCCEE
Confidence            4555555443


No 153
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.54  E-value=11  Score=23.97  Aligned_cols=20  Identities=20%  Similarity=0.496  Sum_probs=14.8

Q ss_pred             CCCccccccccccCChhHHHHHhh
Q 026267           62 TNRFVCEICNKGFQRDQNLQLHRR   85 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~~~~L~~H~~   85 (241)
                      .-.|+|..||..|    .+.+||.
T Consensus        10 tY~Y~c~~cg~~~----dvvq~~~   29 (82)
T COG2331          10 TYSYECTECGNRF----DVVQAMT   29 (82)
T ss_pred             ceEEeecccchHH----HHHHhcc
Confidence            3469999999876    5666665


No 154
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=40.26  E-value=13  Score=25.11  Aligned_cols=21  Identities=19%  Similarity=0.555  Sum_probs=15.9

Q ss_pred             hccccCCceeecccccccccch
Q 026267          132 FSRKHGEKKYKCERCSKKYAVQ  153 (241)
Q Consensus       132 ~~~h~~ek~~~C~~C~k~f~~~  153 (241)
                      +..+.+ ++++|..||..|.-.
T Consensus        72 ~~l~~g-~~~rC~eCG~~fkL~   92 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVFKLV   92 (97)
T ss_pred             EEEeCC-CceeCCCCCcEEEEE
Confidence            455666 789999999988653


No 155
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=40.23  E-value=19  Score=23.98  Aligned_cols=15  Identities=27%  Similarity=0.605  Sum_probs=10.7

Q ss_pred             ceeecccccccccch
Q 026267          139 KKYKCERCSKKYAVQ  153 (241)
Q Consensus       139 k~~~C~~C~k~f~~~  153 (241)
                      -.|.|..|++.|.--
T Consensus        53 GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         53 GIWRCKGCKKTVAGG   67 (90)
T ss_pred             EEEEcCCCCCEEeCC
Confidence            358888888877643


No 156
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=39.92  E-value=29  Score=28.69  Aligned_cols=25  Identities=24%  Similarity=0.543  Sum_probs=17.2

Q ss_pred             ceeecccccccccchhhHHHHHHHh
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKTC  163 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~~  163 (241)
                      -.|.|..|...|-.--+.-.|...|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            3477777777777776666666554


No 157
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=39.74  E-value=24  Score=28.15  Aligned_cols=8  Identities=13%  Similarity=0.775  Sum_probs=5.7

Q ss_pred             ccccCCCC
Q 026267          104 KVYVCPES  111 (241)
Q Consensus       104 ~~~~C~~C  111 (241)
                      +-|.|..|
T Consensus       111 rqFaC~~C  118 (278)
T PF15135_consen  111 RQFACSSC  118 (278)
T ss_pred             eeeecccc
Confidence            56777777


No 158
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=39.20  E-value=32  Score=24.64  Aligned_cols=18  Identities=17%  Similarity=0.593  Sum_probs=12.4

Q ss_pred             CCCCccccccccccCChh
Q 026267           61 ATNRFVCEICNKGFQRDQ   78 (241)
Q Consensus        61 ~~~~~~C~~C~~~f~~~~   78 (241)
                      ..+.|+|.+|..+.....
T Consensus        77 d~~lYeCnIC~etS~ee~   94 (140)
T PF05290_consen   77 DPKLYECNICKETSAEER   94 (140)
T ss_pred             CCCceeccCcccccchhh
Confidence            347789999987665543


No 159
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=38.73  E-value=44  Score=24.64  Aligned_cols=38  Identities=26%  Similarity=0.542  Sum_probs=17.6

Q ss_pred             Cceeeccccccccc------chhhHHHHHHH--h-----------CCcceecC-CCCC
Q 026267          138 EKKYKCERCSKKYA------VQSDWKAHMKT--C-----------GTREYKCD-CGTI  175 (241)
Q Consensus       138 ek~~~C~~C~k~f~------~~~~L~~H~~~--~-----------~~k~~~C~-C~k~  175 (241)
                      .--.+|..|+|.|-      ..+.+..|+..  |           |+-.++|- ||-+
T Consensus        12 ~~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~~   69 (152)
T PF09416_consen   12 SCVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGSR   69 (152)
T ss_dssp             CCEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT---
T ss_pred             ccEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCCC
Confidence            44567777877774      34566667654  3           23456776 7643


No 160
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=38.67  E-value=21  Score=24.69  Aligned_cols=12  Identities=33%  Similarity=0.836  Sum_probs=8.5

Q ss_pred             ceecC-CCCCcCC
Q 026267          167 EYKCD-CGTIFSR  178 (241)
Q Consensus       167 ~~~C~-C~k~f~~  178 (241)
                      -|.|. |++.|..
T Consensus       102 FYTC~kC~~k~~e  114 (116)
T KOG2907|consen  102 FYTCPKCKYKFTE  114 (116)
T ss_pred             EEEcCccceeeec
Confidence            47787 8877754


No 161
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=38.65  E-value=19  Score=21.18  Aligned_cols=10  Identities=20%  Similarity=0.939  Sum_probs=4.4

Q ss_pred             eecccccccc
Q 026267          141 YKCERCSKKY  150 (241)
Q Consensus       141 ~~C~~C~k~f  150 (241)
                      +.|..||+.|
T Consensus        19 ~~Cr~Cg~~~   28 (57)
T cd00065          19 HHCRNCGRIF   28 (57)
T ss_pred             cccCcCcCCc
Confidence            3444444443


No 162
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=37.85  E-value=24  Score=31.06  Aligned_cols=25  Identities=32%  Similarity=0.656  Sum_probs=21.9

Q ss_pred             ceeecccccccccchhhHHHHHHH-h
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKT-C  163 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~-~  163 (241)
                      +-|.|..|.+.|.....+..|+.. |
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhh
Confidence            347899999999999999999987 7


No 163
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=37.24  E-value=18  Score=18.67  Aligned_cols=11  Identities=18%  Similarity=0.682  Sum_probs=6.1

Q ss_pred             ceeeccccccc
Q 026267          139 KKYKCERCSKK  149 (241)
Q Consensus       139 k~~~C~~C~k~  149 (241)
                      ..|.|..|+..
T Consensus        18 ~~~vCp~C~~e   28 (30)
T PF08274_consen   18 ELLVCPECGHE   28 (30)
T ss_dssp             SSEEETTTTEE
T ss_pred             CEEeCCccccc
Confidence            34666666543


No 164
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.74  E-value=21  Score=24.56  Aligned_cols=15  Identities=13%  Similarity=0.113  Sum_probs=10.1

Q ss_pred             Cceeecccccccccc
Q 026267          138 EKKYKCERCSKKYAV  152 (241)
Q Consensus       138 ek~~~C~~C~k~f~~  152 (241)
                      ..|..|.+||+.|..
T Consensus        24 rdPiVsPytG~s~P~   38 (129)
T COG4530          24 RDPIVSPYTGKSYPR   38 (129)
T ss_pred             CCccccCcccccchH
Confidence            456777777777744


No 165
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=36.15  E-value=11  Score=25.39  Aligned_cols=12  Identities=17%  Similarity=0.614  Sum_probs=7.7

Q ss_pred             eecccccccccc
Q 026267          141 YKCERCSKKYAV  152 (241)
Q Consensus       141 ~~C~~C~k~f~~  152 (241)
                      ..|..||..|..
T Consensus        47 ~~Cg~CGls~e~   58 (104)
T COG4888          47 AVCGNCGLSFEC   58 (104)
T ss_pred             EEcccCcceEEE
Confidence            567777766643


No 166
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=35.89  E-value=15  Score=24.65  Aligned_cols=36  Identities=25%  Similarity=0.564  Sum_probs=10.9

Q ss_pred             CceeecccccccccchhhHHHHHHHhCCcceec-C-CCCCcCC
Q 026267          138 EKKYKCERCSKKYAVQSDWKAHMKTCGTREYKC-D-CGTIFSR  178 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C-~-C~k~f~~  178 (241)
                      .|.-.|..||+.+..-     +...-|+|.|.| + |-+.|.+
T Consensus        12 ~ke~~CalCG~tWg~~-----y~Ev~G~rLfFCCd~ca~EF~n   49 (105)
T PF11494_consen   12 TKEMGCALCGATWGDY-----YEEVDGERLFFCCDDCAKEFKN   49 (105)
T ss_dssp             SGGGS-SS---S---S-----S-B-TT--BSSS--SSSS-TTS
T ss_pred             cccccccccCCcHHHH-----HHhhcCCEEEEEcHHHHHHHHH
Confidence            3444566666554422     223345554433 4 6666654


No 167
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=35.77  E-value=41  Score=25.14  Aligned_cols=21  Identities=33%  Similarity=0.860  Sum_probs=14.7

Q ss_pred             ceeecccccccccchhhHHHH
Q 026267          139 KKYKCERCSKKYAVQSDWKAH  159 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H  159 (241)
                      .-|.|..||+.|..-+++..=
T Consensus       129 ~f~~C~~CgkiYW~GsHw~~m  149 (165)
T COG1656         129 EFYRCPKCGKIYWKGSHWRRM  149 (165)
T ss_pred             ceeECCCCcccccCchHHHHH
Confidence            456788888888877666543


No 168
>COG1773 Rubredoxin [Energy production and conversion]
Probab=35.55  E-value=17  Score=21.70  Aligned_cols=15  Identities=20%  Similarity=0.773  Sum_probs=11.6

Q ss_pred             eeecccccccccchh
Q 026267          140 KYKCERCSKKYAVQS  154 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~  154 (241)
                      .|+|..||..|.-..
T Consensus         3 ~~~C~~CG~vYd~e~   17 (55)
T COG1773           3 RWRCSVCGYVYDPEK   17 (55)
T ss_pred             ceEecCCceEecccc
Confidence            588999998886543


No 169
>PRK04023 DNA polymerase II large subunit; Validated
Probab=35.53  E-value=40  Score=32.72  Aligned_cols=11  Identities=36%  Similarity=0.718  Sum_probs=6.9

Q ss_pred             CCccccccccc
Q 026267           63 NRFVCEICNKG   73 (241)
Q Consensus        63 ~~~~C~~C~~~   73 (241)
                      ....|+.||..
T Consensus       625 g~RfCpsCG~~  635 (1121)
T PRK04023        625 GRRKCPSCGKE  635 (1121)
T ss_pred             cCccCCCCCCc
Confidence            34567777765


No 170
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=35.52  E-value=42  Score=28.00  Aligned_cols=25  Identities=24%  Similarity=0.608  Sum_probs=18.2

Q ss_pred             ceeecccccccccchhhHHHHHHHh
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKTC  163 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~~  163 (241)
                      -.|.|..|...|-.--+.-.|...|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh
Confidence            3488888888887777777776654


No 171
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=35.44  E-value=31  Score=28.32  Aligned_cols=24  Identities=29%  Similarity=0.491  Sum_probs=12.3

Q ss_pred             ceeecccccccccchhhHHHHHHH
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      .-|.|+.|-+-|.....|.+|+..
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHHh
Confidence            345555555555555555555443


No 173
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=35.40  E-value=15  Score=20.21  Aligned_cols=10  Identities=30%  Similarity=1.315  Sum_probs=5.6

Q ss_pred             eecccccccc
Q 026267          141 YKCERCSKKY  150 (241)
Q Consensus       141 ~~C~~C~k~f  150 (241)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5565565544


No 174
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=35.25  E-value=22  Score=32.11  Aligned_cols=28  Identities=21%  Similarity=0.451  Sum_probs=20.6

Q ss_pred             CCcceecC-CCCCcCCcchHHHHHHhccC
Q 026267          164 GTREYKCD-CGTIFSRRDSFITHRAFCDA  191 (241)
Q Consensus       164 ~~k~~~C~-C~k~f~~~~~L~~H~~~~~~  191 (241)
                      ..++-.|. ||.+|.......+||..|..
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhh
Confidence            34567788 88888888877777777743


No 175
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=34.69  E-value=17  Score=26.66  Aligned_cols=14  Identities=14%  Similarity=0.717  Sum_probs=8.9

Q ss_pred             eeecccccccccch
Q 026267          140 KYKCERCSKKYAVQ  153 (241)
Q Consensus       140 ~~~C~~C~k~f~~~  153 (241)
                      .-.|..||..|.+.
T Consensus        28 RReC~~C~~RFTTf   41 (156)
T COG1327          28 RRECLECGERFTTF   41 (156)
T ss_pred             hhcccccccccchh
Confidence            34677777776654


No 176
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=34.51  E-value=14  Score=33.10  Aligned_cols=9  Identities=22%  Similarity=0.811  Sum_probs=4.7

Q ss_pred             eeecccccc
Q 026267          140 KYKCERCSK  148 (241)
Q Consensus       140 ~~~C~~C~k  148 (241)
                      +..|..||.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            445555553


No 177
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=34.40  E-value=18  Score=26.49  Aligned_cols=16  Identities=13%  Similarity=0.613  Sum_probs=10.5

Q ss_pred             eeecccccccccchhh
Q 026267          140 KYKCERCSKKYAVQSD  155 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~  155 (241)
                      .-.|..||+.|++-..
T Consensus        28 RReC~~C~~RFTTyEr   43 (147)
T TIGR00244        28 RRECLECHERFTTFER   43 (147)
T ss_pred             cccCCccCCccceeee
Confidence            3567777777776543


No 178
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=34.33  E-value=11  Score=27.55  Aligned_cols=32  Identities=25%  Similarity=0.866  Sum_probs=20.9

Q ss_pred             ceeecccccccccchhhHHHHHHHhCCcceecC-CCCCcC
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFS  177 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~  177 (241)
                      -.|.|..|+..+....      +. ....|.|. |+-.|.
T Consensus       122 ~~~~C~~C~~~~~r~~------~~-~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHR------RS-KRKRYRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeeeec------cc-chhhEECCCCCCEEE
Confidence            3588999998775442      22 23458898 886654


No 179
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=34.24  E-value=11  Score=22.13  Aligned_cols=27  Identities=30%  Similarity=0.631  Sum_probs=16.5

Q ss_pred             CCCccccccccccCChhHHHHHhhhcC
Q 026267           62 TNRFVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      ...|.|+.|...|-..-.+-.|...|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CCeEECCCCCCccccCcChhhhccccC
Confidence            457999999999998888887776664


No 180
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=33.54  E-value=12  Score=18.93  Aligned_cols=9  Identities=44%  Similarity=1.150  Sum_probs=4.1

Q ss_pred             ecccccccc
Q 026267          142 KCERCSKKY  150 (241)
Q Consensus       142 ~C~~C~k~f  150 (241)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344444444


No 181
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=33.48  E-value=21  Score=20.74  Aligned_cols=18  Identities=17%  Similarity=0.698  Sum_probs=13.5

Q ss_pred             Cceeecccccccccchhh
Q 026267          138 EKKYKCERCSKKYAVQSD  155 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~  155 (241)
                      ++.+.|..||..|.....
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            467889999988876544


No 182
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=33.25  E-value=25  Score=21.22  Aligned_cols=15  Identities=13%  Similarity=0.536  Sum_probs=10.2

Q ss_pred             ceeecccccccccch
Q 026267          139 KKYKCERCSKKYAVQ  153 (241)
Q Consensus       139 k~~~C~~C~k~f~~~  153 (241)
                      ..+.|..||.....+
T Consensus        36 D~irCReCG~RIlyK   50 (62)
T KOG3507|consen   36 DVIRCRECGYRILYK   50 (62)
T ss_pred             CcEehhhcchHHHHH
Confidence            357888888765554


No 183
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=33.06  E-value=16  Score=26.58  Aligned_cols=32  Identities=25%  Similarity=0.807  Sum_probs=19.0

Q ss_pred             eeecccccccccchhhHHHHHHHhCCcceecC-CCCCcC
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTIFS  177 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~f~  177 (241)
                      .|.|..|+..+.+      +.+......|.|. |+-.|.
T Consensus       112 ~y~C~~C~~~~~~------~rr~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLR------VRRSNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCce------EccccCcceEEcCCCCCEEE
Confidence            5788888876642      2222122668887 876553


No 184
>PRK14873 primosome assembly protein PriA; Provisional
Probab=33.03  E-value=13  Score=34.41  Aligned_cols=9  Identities=33%  Similarity=1.294  Sum_probs=4.2

Q ss_pred             eeecccccc
Q 026267          140 KYKCERCSK  148 (241)
Q Consensus       140 ~~~C~~C~k  148 (241)
                      ++.|..||.
T Consensus       422 p~~Cp~Cgs  430 (665)
T PRK14873        422 DWRCPRCGS  430 (665)
T ss_pred             CccCCCCcC
Confidence            344555543


No 185
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=32.50  E-value=12  Score=26.17  Aligned_cols=16  Identities=19%  Similarity=0.499  Sum_probs=10.7

Q ss_pred             CCCccccccccccCCh
Q 026267           62 TNRFVCEICNKGFQRD   77 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~~   77 (241)
                      ...+.|.-||..+...
T Consensus        20 ~~~l~C~kCgye~~~~   35 (113)
T COG1594          20 GGKLVCRKCGYEEEAS   35 (113)
T ss_pred             CcEEECCCCCcchhcc
Confidence            3467788888766554


No 186
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=32.35  E-value=25  Score=24.48  Aligned_cols=12  Identities=25%  Similarity=0.465  Sum_probs=7.0

Q ss_pred             eecccccccccc
Q 026267          141 YKCERCSKKYAV  152 (241)
Q Consensus       141 ~~C~~C~k~f~~  152 (241)
                      +.|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PRK12380         71 AWCWDCSQVVEI   82 (113)
T ss_pred             EEcccCCCEEec
Confidence            556666655544


No 187
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=32.23  E-value=20  Score=31.03  Aligned_cols=38  Identities=21%  Similarity=0.580  Sum_probs=26.4

Q ss_pred             cCccccCCCCCcccCCCCCcCCChhhHhhhhccccCCceeeccccccc
Q 026267          102 RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCSKK  149 (241)
Q Consensus       102 ~~~~~~C~~C~c~~~~~~~~f~~~~~l~~H~~~h~~ek~~~C~~C~k~  149 (241)
                      ....|.|+.|       .+.|.....++   ..-...--|.|..|+-.
T Consensus       125 ~~~~Y~Cp~C-------~kkyt~Lea~~---L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  125 NVAGYVCPNC-------QKKYTSLEALQ---LLDNETGEFHCENCGGE  162 (436)
T ss_pred             ccccccCCcc-------ccchhhhHHHH---hhcccCceEEEecCCCc
Confidence            4577999999       88887765443   33333345999999743


No 188
>PRK14873 primosome assembly protein PriA; Provisional
Probab=31.81  E-value=33  Score=31.92  Aligned_cols=28  Identities=18%  Similarity=0.667  Sum_probs=19.4

Q ss_pred             ccccCCceeecccccccccchhhHHHHHHHhCCcceecC-CCCC
Q 026267          133 SRKHGEKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTI  175 (241)
Q Consensus       133 ~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~  175 (241)
                      ..|.......|..||..               ..+..|. |+..
T Consensus       403 ~~h~~~~~l~Ch~CG~~---------------~~p~~Cp~Cgs~  431 (665)
T PRK14873        403 GLPSAGGTPRCRWCGRA---------------APDWRCPRCGSD  431 (665)
T ss_pred             eEecCCCeeECCCCcCC---------------CcCccCCCCcCC
Confidence            34555667899999953               1366899 9865


No 189
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=31.04  E-value=18  Score=27.31  Aligned_cols=15  Identities=20%  Similarity=0.346  Sum_probs=10.3

Q ss_pred             hhhcCccccCCCCCc
Q 026267           99 KEVRKKVYVCPESTC  113 (241)
Q Consensus        99 ~~~~~~~~~C~~C~c  113 (241)
                      .+..+..|.|++|.+
T Consensus       125 ~~~~~~~~~CPiCl~  139 (187)
T KOG0320|consen  125 PLRKEGTYKCPICLD  139 (187)
T ss_pred             ccccccccCCCceec
Confidence            334566799999943


No 190
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=30.99  E-value=33  Score=32.25  Aligned_cols=28  Identities=18%  Similarity=0.553  Sum_probs=17.3

Q ss_pred             cccCCceeecccccccccchhhHHHHHHHhCCcceecC-CCCC
Q 026267          134 RKHGEKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGTI  175 (241)
Q Consensus       134 ~h~~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k~  175 (241)
                      .|.......|..||..              ...|..|. ||-.
T Consensus       456 ~H~~~~~L~CH~Cg~~--------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         456 LHKATGQLRCHYCGYQ--------------EPIPQSCPECGSE  484 (730)
T ss_pred             EecCCCeeEeCCCCCC--------------CCCCCCCCCCCCC
Confidence            3444455778888754              23567787 8754


No 191
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=30.68  E-value=23  Score=25.36  Aligned_cols=17  Identities=35%  Similarity=1.128  Sum_probs=12.6

Q ss_pred             CCceeecccccccccch
Q 026267          137 GEKKYKCERCSKKYAVQ  153 (241)
Q Consensus       137 ~ek~~~C~~C~k~f~~~  153 (241)
                      +...|+|..|++.|...
T Consensus        50 ~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          50 GHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccccCCcCcceeee
Confidence            35568888888888754


No 192
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=30.58  E-value=32  Score=18.52  Aligned_cols=7  Identities=57%  Similarity=1.735  Sum_probs=3.0

Q ss_pred             eeccccc
Q 026267          141 YKCERCS  147 (241)
Q Consensus       141 ~~C~~C~  147 (241)
                      |.|..||
T Consensus        26 ~yC~~cG   32 (36)
T PF11781_consen   26 YYCDRCG   32 (36)
T ss_pred             EEhhhCc
Confidence            4444444


No 193
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=30.50  E-value=11  Score=20.69  Aligned_cols=11  Identities=27%  Similarity=0.936  Sum_probs=7.1

Q ss_pred             eeecccccccc
Q 026267          140 KYKCERCSKKY  150 (241)
Q Consensus       140 ~~~C~~C~k~f  150 (241)
                      -|.|..||..|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            36777777655


No 194
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=30.35  E-value=33  Score=30.12  Aligned_cols=38  Identities=13%  Similarity=0.229  Sum_probs=29.6

Q ss_pred             eecccccccccchhhHHHHHHH--hCCcceecCCCCCcCCcchHHHHHHhcc
Q 026267          141 YKCERCSKKYAVQSDWKAHMKT--CGTREYKCDCGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       141 ~~C~~C~k~f~~~~~L~~H~~~--~~~k~~~C~C~k~f~~~~~L~~H~~~~~  190 (241)
                      +.|.+|.|.|.+..+|..|...  |.+            ....|+.+|.-+.
T Consensus       293 lyC~vCnKsFKseKq~kNHEnSKKHke------------nv~eLrqemEEEe  332 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENSKKHKE------------NVAELRQEMEEEE  332 (508)
T ss_pred             eEEeeccccccchHHHHhhHHHHHHHH------------HHHHHHHHHHHhh
Confidence            7899999999999999999887  643            2345667776653


No 195
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=30.28  E-value=37  Score=24.90  Aligned_cols=9  Identities=33%  Similarity=1.014  Sum_probs=6.1

Q ss_pred             eeccccccc
Q 026267          141 YKCERCSKK  149 (241)
Q Consensus       141 ~~C~~C~k~  149 (241)
                      |.|..||..
T Consensus       113 l~C~~Cg~~  121 (146)
T PF07295_consen  113 LVCENCGHE  121 (146)
T ss_pred             EecccCCCE
Confidence            677777754


No 196
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=29.96  E-value=29  Score=18.72  Aligned_cols=19  Identities=32%  Similarity=0.880  Sum_probs=11.9

Q ss_pred             HhhhhccccCCceeecccc
Q 026267          128 IKKHFSRKHGEKKYKCERC  146 (241)
Q Consensus       128 l~~H~~~h~~ek~~~C~~C  146 (241)
                      +.+|-+...|...|.|..|
T Consensus        17 v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   17 VKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             ceeCCCCCCCCEeEecCcC
Confidence            4455555666666777766


No 197
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=29.72  E-value=48  Score=18.56  Aligned_cols=16  Identities=19%  Similarity=0.765  Sum_probs=12.8

Q ss_pred             cccccccccCChhHHH
Q 026267           66 VCEICNKGFQRDQNLQ   81 (241)
Q Consensus        66 ~C~~C~~~f~~~~~L~   81 (241)
                      .|..||+.|.......
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            4999999998776554


No 198
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=29.32  E-value=30  Score=16.79  Aligned_cols=12  Identities=25%  Similarity=0.786  Sum_probs=9.0

Q ss_pred             eecCCCCCcCCc
Q 026267          168 YKCDCGTIFSRR  179 (241)
Q Consensus       168 ~~C~C~k~f~~~  179 (241)
                      |.|.|...|...
T Consensus         2 y~C~C~~Gy~l~   13 (24)
T PF12662_consen    2 YTCSCPPGYQLS   13 (24)
T ss_pred             EEeeCCCCCcCC
Confidence            788888888643


No 199
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=29.30  E-value=22  Score=19.86  Aligned_cols=15  Identities=27%  Similarity=0.955  Sum_probs=9.3

Q ss_pred             ceeecccccccccch
Q 026267          139 KKYKCERCSKKYAVQ  153 (241)
Q Consensus       139 k~~~C~~C~k~f~~~  153 (241)
                      -+|.|..|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            468899998888765


No 200
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=28.92  E-value=19  Score=30.21  Aligned_cols=23  Identities=13%  Similarity=0.423  Sum_probs=10.8

Q ss_pred             eeecccccccccchhhHHHHHHH
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      -|.|.+|++.=.+...|..|...
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s  101 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLS  101 (381)
T ss_pred             cccCCcccccccchhHHHHHhhh
Confidence            34455555444444444444444


No 201
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=28.15  E-value=34  Score=23.21  Aligned_cols=16  Identities=19%  Similarity=0.524  Sum_probs=13.2

Q ss_pred             CccccccccccCChhH
Q 026267           64 RFVCEICNKGFQRDQN   79 (241)
Q Consensus        64 ~~~C~~C~~~f~~~~~   79 (241)
                      ++.|..||..|.+-..
T Consensus         2 pH~CtrCG~vf~~g~~   17 (112)
T COG3364           2 PHQCTRCGEVFDDGSE   17 (112)
T ss_pred             CceecccccccccccH
Confidence            6789999999988543


No 202
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=27.75  E-value=44  Score=18.16  Aligned_cols=23  Identities=26%  Similarity=0.717  Sum_probs=9.5

Q ss_pred             CCccccccccccC-ChhHH-HHHhh
Q 026267           63 NRFVCEICNKGFQ-RDQNL-QLHRR   85 (241)
Q Consensus        63 ~~~~C~~C~~~f~-~~~~L-~~H~~   85 (241)
                      +.|-|+.|..-|. +.... +.|.+
T Consensus         2 ~ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    2 PRYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             -S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             cCeecccccceecCCChHHHHHhhc
Confidence            4588999999993 44333 55643


No 203
>PTZ00448 hypothetical protein; Provisional
Probab=27.12  E-value=40  Score=28.66  Aligned_cols=23  Identities=17%  Similarity=0.547  Sum_probs=20.9

Q ss_pred             eeecccccccccchhhHHHHHHH
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      .|.|..|+..|......+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999988999999987


No 204
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=27.03  E-value=33  Score=24.00  Aligned_cols=13  Identities=23%  Similarity=0.777  Sum_probs=7.5

Q ss_pred             eeecccccccccc
Q 026267          140 KYKCERCSKKYAV  152 (241)
Q Consensus       140 ~~~C~~C~k~f~~  152 (241)
                      .+.|..||..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3566666655544


No 205
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=26.88  E-value=33  Score=20.61  Aligned_cols=35  Identities=17%  Similarity=0.464  Sum_probs=19.9

Q ss_pred             CCCccccccccccCChhHHHHHhhhcCCCchhhhcchhhhcCccccCCCCCc
Q 026267           62 TNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEVRKKVYVCPESTC  113 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~~~~~C~~C~c  113 (241)
                      +.|++...|+..|.... +..+++                ..+...|++-||
T Consensus        22 ~~PV~s~~C~H~fek~a-I~~~i~----------------~~~~~~CPv~GC   56 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEA-ILQYIQ----------------RNGSKRCPVAGC   56 (57)
T ss_dssp             SSEEEESSS--EEEHHH-HHHHCT----------------TTS-EE-SCCC-
T ss_pred             hCCcCcCCCCCeecHHH-HHHHHH----------------hcCCCCCCCCCC
Confidence            46777888999997754 444542                456678988655


No 206
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=26.77  E-value=29  Score=18.77  Aligned_cols=12  Identities=42%  Similarity=0.946  Sum_probs=6.2

Q ss_pred             ceeecccccccc
Q 026267          139 KKYKCERCSKKY  150 (241)
Q Consensus       139 k~~~C~~C~k~f  150 (241)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            457888888654


No 207
>PF12907 zf-met2:  Zinc-binding
Probab=26.58  E-value=34  Score=18.98  Aligned_cols=22  Identities=18%  Similarity=0.533  Sum_probs=11.5

Q ss_pred             eeccccccccc---chhhHHHHHHH
Q 026267          141 YKCERCSKKYA---VQSDWKAHMKT  162 (241)
Q Consensus       141 ~~C~~C~k~f~---~~~~L~~H~~~  162 (241)
                      +.|.+|-..|.   +...|..|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~en   26 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAEN   26 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHc
Confidence            45666664443   33446666555


No 208
>PLN02294 cytochrome c oxidase subunit Vb
Probab=26.56  E-value=31  Score=25.91  Aligned_cols=17  Identities=24%  Similarity=0.725  Sum_probs=13.4

Q ss_pred             CCCCccccccccccCCh
Q 026267           61 ATNRFVCEICNKGFQRD   77 (241)
Q Consensus        61 ~~~~~~C~~C~~~f~~~   77 (241)
                      ..+++.|.+||..|.-.
T Consensus       138 kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        138 KGKSFECPVCTQYFELE  154 (174)
T ss_pred             CCCceeCCCCCCEEEEE
Confidence            45689999999998543


No 209
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=26.39  E-value=54  Score=20.17  Aligned_cols=15  Identities=13%  Similarity=0.534  Sum_probs=9.5

Q ss_pred             Cceeecccccccccc
Q 026267          138 EKKYKCERCSKKYAV  152 (241)
Q Consensus       138 ek~~~C~~C~k~f~~  152 (241)
                      .+.|.|..||..+.+
T Consensus        44 ~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   44 GRVFTCPNCGFEMDR   58 (69)
T ss_pred             cceEEcCCCCCEECc
Confidence            456777777766443


No 210
>KOG4727 consensus U1-like Zn-finger protein [General function prediction only]
Probab=26.10  E-value=42  Score=25.16  Aligned_cols=24  Identities=17%  Similarity=0.451  Sum_probs=21.5

Q ss_pred             CCCccccccccccCChhHHHHHhh
Q 026267           62 TNRFVCEICNKGFQRDQNLQLHRR   85 (241)
Q Consensus        62 ~~~~~C~~C~~~f~~~~~L~~H~~   85 (241)
                      ...|-|.+|+-+|.+..++..|+.
T Consensus        73 ~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   73 KGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             cCceeeeecceeehhhHHHHHHhc
Confidence            457899999999999999999975


No 211
>KOG2636 consensus Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=25.91  E-value=46  Score=29.01  Aligned_cols=29  Identities=21%  Similarity=0.472  Sum_probs=23.3

Q ss_pred             cccCCceeeccccc-ccccchhhHHHHHHH
Q 026267          134 RKHGEKKYKCERCS-KKYAVQSDWKAHMKT  162 (241)
Q Consensus       134 ~h~~ek~~~C~~C~-k~f~~~~~L~~H~~~  162 (241)
                      .|-=...|.|.+|| +++.-...+.+|..-
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~E  424 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFNE  424 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhHH
Confidence            34445679999999 889999999999764


No 212
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=25.83  E-value=33  Score=23.97  Aligned_cols=12  Identities=33%  Similarity=0.827  Sum_probs=6.4

Q ss_pred             eecccccccccc
Q 026267          141 YKCERCSKKYAV  152 (241)
Q Consensus       141 ~~C~~C~k~f~~  152 (241)
                      +.|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            455555555544


No 213
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=25.56  E-value=47  Score=27.34  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=5.7

Q ss_pred             eeeccccccccc
Q 026267          140 KYKCERCSKKYA  151 (241)
Q Consensus       140 ~~~C~~C~k~f~  151 (241)
                      ..+|+.|+..+.
T Consensus        26 ~~~c~~c~~~~~   37 (285)
T TIGR00515        26 WTKCPKCGQVLY   37 (285)
T ss_pred             eeECCCCcchhh
Confidence            345555554433


No 214
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=25.09  E-value=25  Score=24.44  Aligned_cols=14  Identities=14%  Similarity=0.778  Sum_probs=8.4

Q ss_pred             eeecccccccccch
Q 026267          140 KYKCERCSKKYAVQ  153 (241)
Q Consensus       140 ~~~C~~C~k~f~~~  153 (241)
                      .+.|..||+.|.-.
T Consensus        70 ~~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   70 RARCRDCGHEFEPD   83 (113)
T ss_dssp             EEEETTTS-EEECH
T ss_pred             cEECCCCCCEEecC
Confidence            35677777776654


No 215
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=24.85  E-value=25  Score=24.01  Aligned_cols=8  Identities=38%  Similarity=1.173  Sum_probs=4.6

Q ss_pred             eecccccc
Q 026267          141 YKCERCSK  148 (241)
Q Consensus       141 ~~C~~C~k  148 (241)
                      |.|..|+.
T Consensus        32 y~C~~C~A   39 (102)
T PF11672_consen   32 YVCTPCDA   39 (102)
T ss_pred             EECCCCCc
Confidence            56666653


No 216
>PF07150 DUF1390:  Protein of unknown function (DUF1390);  InterPro: IPR009820 This entry is represented by Paramecium bursaria Chlorella virus 1, A79R; it is a family of uncharacterised viral proteins.
Probab=24.74  E-value=20  Score=28.36  Aligned_cols=19  Identities=26%  Similarity=0.562  Sum_probs=9.7

Q ss_pred             eeecccccccccchhhHHHH
Q 026267          140 KYKCERCSKKYAVQSDWKAH  159 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H  159 (241)
                      -|.| .||.......+..+|
T Consensus         7 lY~C-~CGYkT~~~gnAsKH   25 (229)
T PF07150_consen    7 LYTC-GCGYKTTNKGNASKH   25 (229)
T ss_pred             EEEe-cCCceecCCcccccc
Confidence            3555 355555555544444


No 217
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=24.74  E-value=28  Score=18.53  Aligned_cols=14  Identities=29%  Similarity=0.572  Sum_probs=7.7

Q ss_pred             ccccccccccCChh
Q 026267           65 FVCEICNKGFQRDQ   78 (241)
Q Consensus        65 ~~C~~C~~~f~~~~   78 (241)
                      -.|..|++.|....
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            36999999998765


No 218
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=24.71  E-value=57  Score=19.42  Aligned_cols=13  Identities=23%  Similarity=0.728  Sum_probs=7.1

Q ss_pred             Cceeecccccccc
Q 026267          138 EKKYKCERCSKKY  150 (241)
Q Consensus       138 ek~~~C~~C~k~f  150 (241)
                      +--..|..|+..+
T Consensus        19 dDiVvCp~Cgapy   31 (54)
T PF14446_consen   19 DDIVVCPECGAPY   31 (54)
T ss_pred             CCEEECCCCCCcc
Confidence            3345666666553


No 219
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=24.69  E-value=30  Score=32.15  Aligned_cols=21  Identities=38%  Similarity=0.738  Sum_probs=14.6

Q ss_pred             CcceecC-CCCCcCCcchHHHH
Q 026267          165 TREYKCD-CGTIFSRRDSFITH  185 (241)
Q Consensus       165 ~k~~~C~-C~k~f~~~~~L~~H  185 (241)
                      .|.-+|+ |+..|.-..-+..|
T Consensus       676 tRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  676 TRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             HhcCCCCCCCCCCCcccccccC
Confidence            3566888 99888876655444


No 220
>PTZ00064 histone acetyltransferase; Provisional
Probab=24.62  E-value=47  Score=29.56  Aligned_cols=26  Identities=27%  Similarity=0.551  Sum_probs=19.5

Q ss_pred             CcceecC-CCCCcCCcchHHHHHHhcc
Q 026267          165 TREYKCD-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       165 ~k~~~C~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      ...|.|+ |-+-|.....|.+|+..+.
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~C~  304 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSRCQ  304 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhcCC
Confidence            3457888 8888888888888877654


No 221
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=24.49  E-value=45  Score=18.48  Aligned_cols=12  Identities=25%  Similarity=0.755  Sum_probs=9.5

Q ss_pred             ceeecccccccc
Q 026267          139 KKYKCERCSKKY  150 (241)
Q Consensus       139 k~~~C~~C~k~f  150 (241)
                      +.-.|..||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467888888877


No 222
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=24.37  E-value=27  Score=20.55  Aligned_cols=13  Identities=15%  Similarity=0.871  Sum_probs=7.3

Q ss_pred             cccccccccCChh
Q 026267           66 VCEICNKGFQRDQ   78 (241)
Q Consensus        66 ~C~~C~~~f~~~~   78 (241)
                      .|++|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999999997643


No 223
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=24.35  E-value=13  Score=23.54  Aligned_cols=38  Identities=26%  Similarity=0.706  Sum_probs=15.7

Q ss_pred             hhhccccCCceeecccccccccchhhHHHHHHHhCCcceecC-CCC
Q 026267          130 KHFSRKHGEKKYKCERCSKKYAVQSDWKAHMKTCGTREYKCD-CGT  174 (241)
Q Consensus       130 ~H~~~h~~ek~~~C~~C~k~f~~~~~L~~H~~~~~~k~~~C~-C~k  174 (241)
                      .|.......+...|..|+..+.....      ..+ ..|.|. |+.
T Consensus        31 ~H~~~~~~~~~v~Cg~C~~~~~~~~~------~c~-~~~~C~~C~~   69 (71)
T PF05495_consen   31 DHPFDRWPVKRVICGKCRTEQPIDEY------SCG-ADYFCPICGL   69 (71)
T ss_dssp             SS---TTT--EEEETTT--EEES-SB------TT---SEEETTTTE
T ss_pred             cCccccccccCeECCCCCCccChhhh------hcC-CCccCcCcCC
Confidence            44433334446777777776655433      111 456676 654


No 224
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=24.27  E-value=44  Score=29.37  Aligned_cols=28  Identities=25%  Similarity=0.641  Sum_probs=22.6

Q ss_pred             CCcceecC-CCCCcCCcchHHHHHHhccC
Q 026267          164 GTREYKCD-CGTIFSRRDSFITHRAFCDA  191 (241)
Q Consensus       164 ~~k~~~C~-C~k~f~~~~~L~~H~~~~~~  191 (241)
                      ....|.|+ |-+-|.....|.+|+..+.-
T Consensus       195 ~~~lyiCe~Cl~y~~~~~~~~~H~~~C~~  223 (450)
T PLN00104        195 CSKLYFCEFCLKFMKRKEQLQRHMKKCDL  223 (450)
T ss_pred             CCeEEEchhhhhhhcCHHHHHHHHhcCCC
Confidence            34678999 99999999999999876643


No 225
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=23.87  E-value=42  Score=29.25  Aligned_cols=23  Identities=17%  Similarity=0.375  Sum_probs=14.4

Q ss_pred             eeecccccccccchhhHHHHHHH
Q 026267          140 KYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      -|.|++|.+-|...+.|..|...
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhh
Confidence            35666666666666666666655


No 226
>PTZ00448 hypothetical protein; Provisional
Probab=23.73  E-value=51  Score=28.04  Aligned_cols=24  Identities=25%  Similarity=0.564  Sum_probs=21.2

Q ss_pred             CCccccccccccCChhHHHHHhhh
Q 026267           63 NRFVCEICNKGFQRDQNLQLHRRG   86 (241)
Q Consensus        63 ~~~~C~~C~~~f~~~~~L~~H~~~   86 (241)
                      ..|.|..|+-.|.+....+.|++.
T Consensus       313 ~~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        313 NMLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CCccccccccccCCHHHHHHHhhh
Confidence            368899999999988999999876


No 227
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=23.56  E-value=45  Score=15.84  Aligned_cols=6  Identities=33%  Similarity=1.292  Sum_probs=2.9

Q ss_pred             cccccc
Q 026267          143 CERCSK  148 (241)
Q Consensus       143 C~~C~k  148 (241)
                      |..||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444543


No 228
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=23.54  E-value=57  Score=27.02  Aligned_cols=13  Identities=23%  Similarity=0.345  Sum_probs=6.5

Q ss_pred             eeecccccccccc
Q 026267          140 KYKCERCSKKYAV  152 (241)
Q Consensus       140 ~~~C~~C~k~f~~  152 (241)
                      +.+|+.|++.+..
T Consensus        38 w~kc~~C~~~~~~   50 (296)
T CHL00174         38 WVQCENCYGLNYK   50 (296)
T ss_pred             eeECCCccchhhH
Confidence            3455555554433


No 229
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=23.42  E-value=70  Score=17.49  Aligned_cols=21  Identities=10%  Similarity=0.226  Sum_probs=14.1

Q ss_pred             CceeecccccccccchhhHHH
Q 026267          138 EKKYKCERCSKKYAVQSDWKA  158 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~  158 (241)
                      ..-+.|..|+-.|.....|.+
T Consensus        17 ~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   17 VEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEEECCCCCeEEccHHHHHH
Confidence            455678888777777666654


No 230
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=23.30  E-value=69  Score=26.58  Aligned_cols=16  Identities=13%  Similarity=0.310  Sum_probs=7.8

Q ss_pred             CCCCcCCcchHHHHHH
Q 026267          172 CGTIFSRRDSFITHRA  187 (241)
Q Consensus       172 C~k~f~~~~~L~~H~~  187 (241)
                      |.++|..+..|..|+.
T Consensus       153 C~RTyLsqrDlqAHIn  168 (389)
T KOG2932|consen  153 CLRTYLSQRDLQAHIN  168 (389)
T ss_pred             HHHHHhhHHHHHHHhh
Confidence            4455555545544443


No 231
>KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification]
Probab=23.13  E-value=47  Score=26.17  Aligned_cols=22  Identities=32%  Similarity=0.581  Sum_probs=19.2

Q ss_pred             ceeecccccccccchhhHHHHH
Q 026267          139 KKYKCERCSKKYAVQSDWKAHM  160 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~  160 (241)
                      ..|-|-+||..|.....|..|-
T Consensus       238 eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             cceEEEEeccccCCHHHHHHhC
Confidence            4699999999999999998873


No 232
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=22.85  E-value=1.1e+02  Score=17.24  Aligned_cols=11  Identities=36%  Similarity=1.183  Sum_probs=6.9

Q ss_pred             Cceeecccccc
Q 026267          138 EKKYKCERCSK  148 (241)
Q Consensus       138 ek~~~C~~C~k  148 (241)
                      ...|+|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            45577777754


No 233
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=22.60  E-value=27  Score=29.53  Aligned_cols=14  Identities=21%  Similarity=0.757  Sum_probs=5.4

Q ss_pred             ceeecccccccccc
Q 026267          139 KKYKCERCSKKYAV  152 (241)
Q Consensus       139 k~~~C~~C~k~f~~  152 (241)
                      +-|+|..|++.+..
T Consensus       284 RFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  284 RFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEEE-T-TS-EEEE
T ss_pred             eeEECCCCCCeeee
Confidence            34556555555433


No 234
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=22.54  E-value=41  Score=21.89  Aligned_cols=11  Identities=45%  Similarity=0.975  Sum_probs=6.5

Q ss_pred             eeccccccccc
Q 026267          141 YKCERCSKKYA  151 (241)
Q Consensus       141 ~~C~~C~k~f~  151 (241)
                      |.|..|.+.|.
T Consensus        55 W~C~~C~kv~a   65 (92)
T KOG0402|consen   55 WKCGSCKKVVA   65 (92)
T ss_pred             EecCCccceec
Confidence            66666665554


No 235
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=22.45  E-value=50  Score=23.01  Aligned_cols=12  Identities=25%  Similarity=0.648  Sum_probs=6.6

Q ss_pred             eecccccccccc
Q 026267          141 YKCERCSKKYAV  152 (241)
Q Consensus       141 ~~C~~C~k~f~~  152 (241)
                      +.|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (114)
T PRK03681         71 CWCETCQQYVTL   82 (114)
T ss_pred             EEcccCCCeeec
Confidence            556666654443


No 236
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=22.07  E-value=79  Score=16.66  Aligned_cols=22  Identities=27%  Similarity=0.643  Sum_probs=9.5

Q ss_pred             eecC-CCCCcCCcchHHHHHHhcc
Q 026267          168 YKCD-CGTIFSRRDSFITHRAFCD  190 (241)
Q Consensus       168 ~~C~-C~k~f~~~~~L~~H~~~~~  190 (241)
                      |.|. |++.+. .+.+..|+..+-
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLekCm   27 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLEKCM   27 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHHHHT
T ss_pred             EECCCCcCCcc-hhhhHHHHHHHH
Confidence            4455 555432 233455555443


No 237
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=21.98  E-value=71  Score=16.76  Aligned_cols=12  Identities=17%  Similarity=0.462  Sum_probs=7.1

Q ss_pred             eeeccccccccc
Q 026267          140 KYKCERCSKKYA  151 (241)
Q Consensus       140 ~~~C~~C~k~f~  151 (241)
                      -+.|..||..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            356666666553


No 238
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=21.95  E-value=2.6e+02  Score=20.82  Aligned_cols=23  Identities=9%  Similarity=0.509  Sum_probs=14.0

Q ss_pred             CCccccccccccCChhHHHHHhhhcC
Q 026267           63 NRFVCEICNKGFQRDQNLQLHRRGHN   88 (241)
Q Consensus        63 ~~~~C~~C~~~f~~~~~L~~H~~~h~   88 (241)
                      +||   .|+..|....-|.+-.+.+.
T Consensus        28 Rpy---mc~Ts~rhSNCLdqfkka~~   50 (162)
T PF07800_consen   28 RPY---MCDTSYRHSNCLDQFKKAYG   50 (162)
T ss_pred             ccc---ccCCccchhHHHHHHHHHhc
Confidence            555   45667766666666555554


No 239
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=21.90  E-value=38  Score=19.94  Aligned_cols=18  Identities=11%  Similarity=0.318  Sum_probs=12.3

Q ss_pred             cCCCCCccccccccccCC
Q 026267           59 LLATNRFVCEICNKGFQR   76 (241)
Q Consensus        59 ~~~~~~~~C~~C~~~f~~   76 (241)
                      ......|+|.+|++.|..
T Consensus        30 ~~~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   30 DKEPIKLRCHYCERIITE   47 (52)
T ss_dssp             ETTTCEEEETTT--EEEH
T ss_pred             eCCCCEEEeeCCCCEecc
Confidence            345678999999998854


No 240
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=21.53  E-value=1.4e+02  Score=24.93  Aligned_cols=27  Identities=30%  Similarity=0.656  Sum_probs=21.7

Q ss_pred             Cceeeccc---ccccccchhhHHHHHHH-hC
Q 026267          138 EKKYKCER---CSKKYAVQSDWKAHMKT-CG  164 (241)
Q Consensus       138 ek~~~C~~---C~k~f~~~~~L~~H~~~-~~  164 (241)
                      +--|.|..   |.++|..+.+|..|+.. |+
T Consensus       142 g~iFmC~~~~GC~RTyLsqrDlqAHInhrH~  172 (389)
T KOG2932|consen  142 GGIFMCAAPHGCLRTYLSQRDLQAHINHRHG  172 (389)
T ss_pred             cceEEeecchhHHHHHhhHHHHHHHhhhhhc
Confidence            34688854   99999999999999887 64


No 241
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=21.47  E-value=23  Score=20.21  Aligned_cols=6  Identities=17%  Similarity=0.988  Sum_probs=2.9

Q ss_pred             cccccc
Q 026267          146 CSKKYA  151 (241)
Q Consensus       146 C~k~f~  151 (241)
                      ||..|.
T Consensus        33 Cg~tfv   38 (47)
T PF04606_consen   33 CGHTFV   38 (47)
T ss_pred             CCCEEE
Confidence            555443


No 242
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=21.47  E-value=49  Score=19.02  Aligned_cols=15  Identities=33%  Similarity=0.824  Sum_probs=11.2

Q ss_pred             eeecccccccccchh
Q 026267          140 KYKCERCSKKYAVQS  154 (241)
Q Consensus       140 ~~~C~~C~k~f~~~~  154 (241)
                      .|.|.+||..|.-..
T Consensus         1 ky~C~~CgyvYd~~~   15 (47)
T PF00301_consen    1 KYQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEEETTTSBEEETTT
T ss_pred             CcCCCCCCEEEcCCc
Confidence            378999998876553


No 243
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=21.42  E-value=59  Score=24.69  Aligned_cols=10  Identities=20%  Similarity=1.082  Sum_probs=7.1

Q ss_pred             eecccccccc
Q 026267          141 YKCERCSKKY  150 (241)
Q Consensus       141 ~~C~~C~k~f  150 (241)
                      |.|+.||-..
T Consensus       133 F~Cp~Cg~~L  142 (176)
T COG1675         133 FTCPKCGEDL  142 (176)
T ss_pred             CCCCCCCchh
Confidence            7888887543


No 244
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=21.33  E-value=65  Score=23.48  Aligned_cols=21  Identities=29%  Similarity=0.803  Sum_probs=17.0

Q ss_pred             CceeecccccccccchhhHHH
Q 026267          138 EKKYKCERCSKKYAVQSDWKA  158 (241)
Q Consensus       138 ek~~~C~~C~k~f~~~~~L~~  158 (241)
                      +.-|.|..||+.|..-++..+
T Consensus       122 ~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  122 DEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CeEEECCCCCCEecccccHHH
Confidence            457899999999998876654


No 245
>PLN02748 tRNA dimethylallyltransferase
Probab=21.32  E-value=61  Score=28.80  Aligned_cols=26  Identities=23%  Similarity=0.665  Sum_probs=22.5

Q ss_pred             CCCcccccccc-ccCChhHHHHHhhhc
Q 026267           62 TNRFVCEICNK-GFQRDQNLQLHRRGH   87 (241)
Q Consensus        62 ~~~~~C~~C~~-~f~~~~~L~~H~~~h   87 (241)
                      .+.|.|+.|++ ++....+...|++..
T Consensus       416 ~~~~~Ce~C~~~~~~G~~eW~~Hlksr  442 (468)
T PLN02748        416 WTQYVCEACGNKVLRGAHEWEQHKQGR  442 (468)
T ss_pred             cccccccCCCCcccCCHHHHHHHhcch
Confidence            57889999997 899999999998754


No 246
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=21.07  E-value=53  Score=28.85  Aligned_cols=21  Identities=19%  Similarity=0.452  Sum_probs=19.2

Q ss_pred             eecC-CCCCcCCcchHHHHHHh
Q 026267          168 YKCD-CGTIFSRRDSFITHRAF  188 (241)
Q Consensus       168 ~~C~-C~k~f~~~~~L~~H~~~  188 (241)
                      +.|. |.|.|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899 99999999999999765


No 247
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=21.00  E-value=65  Score=27.24  Aligned_cols=29  Identities=17%  Similarity=0.434  Sum_probs=23.2

Q ss_pred             cccCCceeeccccc-ccccchhhHHHHHHH
Q 026267          134 RKHGEKKYKCERCS-KKYAVQSDWKAHMKT  162 (241)
Q Consensus       134 ~h~~ek~~~C~~C~-k~f~~~~~L~~H~~~  162 (241)
                      .|.=.+-|.|.+|| +.+.-...+.+|..-
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrHF~E  397 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRHFEE  397 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhhhhh
Confidence            34446779999999 788888888888765


No 248
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=20.91  E-value=41  Score=31.71  Aligned_cols=13  Identities=23%  Similarity=0.506  Sum_probs=10.8

Q ss_pred             ccccccccccCCh
Q 026267           65 FVCEICNKGFQRD   77 (241)
Q Consensus        65 ~~C~~C~~~f~~~   77 (241)
                      -.|..|++.|...
T Consensus       461 dtC~~C~kkFfSl  473 (1374)
T PTZ00303        461 DSCPSCGRAFISL  473 (1374)
T ss_pred             CcccCcCCccccc
Confidence            5699999999764


No 249
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=20.89  E-value=40  Score=19.66  Aligned_cols=13  Identities=31%  Similarity=0.812  Sum_probs=10.6

Q ss_pred             eecccccccccch
Q 026267          141 YKCERCSKKYAVQ  153 (241)
Q Consensus       141 ~~C~~C~k~f~~~  153 (241)
                      |+|..||..|.-.
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            7899999888754


No 250
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=20.70  E-value=53  Score=22.45  Aligned_cols=24  Identities=17%  Similarity=0.403  Sum_probs=20.8

Q ss_pred             ceeecccccccccchhhHHHHHHH
Q 026267          139 KKYKCERCSKKYAVQSDWKAHMKT  162 (241)
Q Consensus       139 k~~~C~~C~k~f~~~~~L~~H~~~  162 (241)
                      -.+-|-.|.+-|.+...|..|.+.
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            347899999999999999999875


No 251
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms]
Probab=20.16  E-value=22  Score=32.01  Aligned_cols=12  Identities=33%  Similarity=0.952  Sum_probs=5.8

Q ss_pred             ecccccccccch
Q 026267          142 KCERCSKKYAVQ  153 (241)
Q Consensus       142 ~C~~C~k~f~~~  153 (241)
                      +|..|||.|.++
T Consensus       255 kC~~CgKgFQQK  266 (1004)
T KOG0782|consen  255 KCNTCGKGFQQK  266 (1004)
T ss_pred             ccchhhhhhhhh
Confidence            455555554443


Done!