Query         026283
Match_columns 240
No_of_seqs    45 out of 47
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 05:58:18 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026283.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026283hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00420 hypothetical protein;  98.6 2.8E-08   6E-13   80.6   2.3   35  180-214    22-56  (112)
  2 PF09538 FYDLN_acid:  Protein o  97.0  0.0005 1.1E-08   55.4   2.9   31  181-211     9-39  (108)
  3 PF11023 DUF2614:  Protein of u  96.9  0.0024 5.2E-08   52.7   6.3   37  176-213    64-100 (114)
  4 PRK00398 rpoP DNA-directed RNA  96.7  0.0011 2.3E-08   45.1   2.3   34  180-213     2-36  (46)
  5 PRK02935 hypothetical protein;  96.6  0.0086 1.9E-07   49.3   7.1   39  175-214    64-102 (110)
  6 TIGR02300 FYDLN_acid conserved  96.4  0.0017 3.7E-08   54.5   1.6   31  181-211     9-39  (129)
  7 PF13248 zf-ribbon_3:  zinc-rib  96.2  0.0023 4.9E-08   39.5   1.0   25  181-208     2-26  (26)
  8 smart00531 TFIIE Transcription  95.9  0.0032 6.9E-08   51.7   1.3   34  181-214    99-139 (147)
  9 smart00834 CxxC_CXXC_SSSS Puta  95.9  0.0038 8.3E-08   40.3   1.2   28  181-208     5-36  (41)
 10 TIGR02098 MJ0042_CXXC MJ0042 f  95.9   0.007 1.5E-07   39.2   2.4   29  182-210     3-37  (38)
 11 COG1645 Uncharacterized Zn-fin  95.5  0.0085 1.8E-07   50.4   2.3   33  179-212    26-59  (131)
 12 PF08271 TF_Zn_Ribbon:  TFIIB z  95.5  0.0078 1.7E-07   40.4   1.7   31  182-212     1-33  (43)
 13 PF13240 zinc_ribbon_2:  zinc-r  95.5   0.006 1.3E-07   37.2   0.9   23  183-208     1-23  (23)
 14 PRK05978 hypothetical protein;  95.5  0.0081 1.7E-07   51.1   1.9   36  180-215    32-69  (148)
 15 PF07754 DUF1610:  Domain of un  95.4   0.012 2.5E-07   36.9   1.9   23  184-206     1-24  (24)
 16 COG1592 Rubrerythrin [Energy p  95.3  0.0083 1.8E-07   51.9   1.6   24  182-207   135-158 (166)
 17 PRK03824 hypA hydrogenase nick  95.1   0.013 2.8E-07   48.3   2.0   33  182-214    71-124 (135)
 18 PRK03681 hypA hydrogenase nick  95.1   0.011 2.4E-07   47.4   1.5   33  182-214    71-104 (114)
 19 PF13719 zinc_ribbon_5:  zinc-r  94.6   0.026 5.7E-07   37.3   2.2   27  183-209     4-36  (37)
 20 PF01155 HypA:  Hydrogenase exp  94.5   0.011 2.4E-07   47.0   0.3   32  182-214    71-103 (113)
 21 PF09986 DUF2225:  Uncharacteri  94.5   0.018 3.8E-07   50.3   1.4   31  181-211     5-61  (214)
 22 TIGR01206 lysW lysine biosynth  94.4   0.037 8.1E-07   40.1   2.8   32  181-212     2-36  (54)
 23 PF03966 Trm112p:  Trm112p-like  94.3   0.041   9E-07   40.0   2.7   32  182-213     8-68  (68)
 24 smart00659 RPOLCX RNA polymera  94.2   0.047   1E-06   37.8   2.7   32  182-213     3-34  (44)
 25 PF13717 zinc_ribbon_4:  zinc-r  94.2   0.034 7.4E-07   36.8   1.9   25  183-207     4-34  (36)
 26 PF06677 Auto_anti-p27:  Sjogre  93.8   0.042 9.2E-07   37.8   1.9   28  178-205    14-41  (41)
 27 PF07282 OrfB_Zn_ribbon:  Putat  93.7   0.049 1.1E-06   38.9   2.2   27  181-207    28-55  (69)
 28 PF14353 CpXC:  CpXC protein     93.7   0.041 8.9E-07   43.6   1.9   32  181-212     1-52  (128)
 29 TIGR01405 polC_Gram_pos DNA po  93.7   0.047   1E-06   58.8   2.9   54  183-238   685-746 (1213)
 30 COG0675 Transposase and inacti  93.6   0.042   9E-07   46.7   2.0   22  182-207   310-331 (364)
 31 PRK00564 hypA hydrogenase nick  93.5    0.04 8.7E-07   44.3   1.7   34  181-214    71-105 (117)
 32 PRK12380 hydrogenase nickel in  93.5   0.039 8.5E-07   44.1   1.5   33  181-214    70-103 (113)
 33 TIGR00373 conserved hypothetic  93.4   0.042   9E-07   46.1   1.7   32  182-213   110-143 (158)
 34 cd00350 rubredoxin_like Rubred  93.4   0.046   1E-06   35.3   1.4   23  183-206     3-25  (33)
 35 PF09862 DUF2089:  Protein of u  93.3   0.052 1.1E-06   44.6   2.0   26  184-215     1-26  (113)
 36 PRK14890 putative Zn-ribbon RN  93.3    0.07 1.5E-06   39.8   2.5   28  181-208     7-35  (59)
 37 COG2051 RPS27A Ribosomal prote  92.9   0.078 1.7E-06   40.5   2.2   35  180-214    18-54  (67)
 38 PF08274 PhnA_Zn_Ribbon:  PhnA   92.8   0.055 1.2E-06   35.3   1.2   26  182-207     3-28  (30)
 39 PF10571 UPF0547:  Uncharacteri  92.8   0.058 1.3E-06   33.9   1.2   23  183-208     2-24  (26)
 40 COG2888 Predicted Zn-ribbon RN  92.8   0.067 1.5E-06   40.2   1.8   28  183-210    11-39  (61)
 41 PF01363 FYVE:  FYVE zinc finge  92.7   0.083 1.8E-06   37.6   2.1   28  181-209     9-36  (69)
 42 PRK06266 transcription initiat  92.6   0.049 1.1E-06   46.8   1.0   33  180-212   116-150 (178)
 43 PF07191 zinc-ribbons_6:  zinc-  92.5   0.077 1.7E-06   40.6   1.8   46  181-226     1-64  (70)
 44 PRK12495 hypothetical protein;  92.0   0.084 1.8E-06   48.0   1.8   28  182-210    43-70  (226)
 45 PRK00448 polC DNA polymerase I  91.9    0.11 2.4E-06   56.9   2.8   55  182-238   909-971 (1437)
 46 cd00729 rubredoxin_SM Rubredox  91.7     0.1 2.2E-06   34.2   1.4   24  183-207     4-27  (34)
 47 PLN03120 nucleic acid binding   91.3    0.23   5E-06   45.8   3.8   55   63-117   137-191 (260)
 48 TIGR00100 hypA hydrogenase nic  91.3    0.12 2.5E-06   41.5   1.6   34  180-214    69-103 (115)
 49 PRK00415 rps27e 30S ribosomal   91.2    0.12 2.6E-06   38.4   1.5   36  179-214     9-46  (59)
 50 PRK08270 anaerobic ribonucleos  91.1    0.11 2.4E-06   52.7   1.6   29  178-210   623-651 (656)
 51 COG1096 Predicted RNA-binding   91.0    0.12 2.7E-06   45.8   1.7   30  179-209   147-176 (188)
 52 KOG2879 Predicted E3 ubiquitin  90.8    0.32   7E-06   45.8   4.3   28  182-209   240-287 (298)
 53 TIGR02605 CxxC_CxxC_SSSS putat  90.8    0.11 2.3E-06   35.5   0.9   26  181-206     5-34  (52)
 54 PF03604 DNA_RNApol_7kD:  DNA d  90.7    0.19   4E-06   33.1   1.9   29  183-211     2-30  (32)
 55 PRK00464 nrdR transcriptional   90.3    0.17 3.6E-06   43.2   1.9   26  182-207     1-37  (154)
 56 PRK00432 30S ribosomal protein  90.3    0.23 4.9E-06   35.2   2.2   28  183-210    22-49  (50)
 57 PRK12496 hypothetical protein;  90.3    0.14 3.1E-06   43.4   1.4   31  182-213   128-158 (164)
 58 PF12773 DZR:  Double zinc ribb  90.2    0.13 2.9E-06   34.7   0.9   26  182-207    13-38  (50)
 59 PRK08579 anaerobic ribonucleos  90.1    0.15 3.2E-06   51.6   1.6   24  181-207   568-591 (625)
 60 PF12773 DZR:  Double zinc ribb  89.7    0.15 3.3E-06   34.4   0.9   23  184-209     1-23  (50)
 61 PRK00762 hypA hydrogenase nick  89.3    0.18   4E-06   40.9   1.3   33  181-214    70-109 (124)
 62 PHA02942 putative transposase;  88.6    0.33   7E-06   46.0   2.5   28  181-208   325-352 (383)
 63 TIGR00686 phnA alkylphosphonat  87.8    0.31 6.7E-06   40.2   1.7   28  182-209     3-30  (109)
 64 PRK00423 tfb transcription ini  87.7    0.63 1.4E-05   42.6   3.8   28  182-209    12-41  (310)
 65 PF09297 zf-NADH-PPase:  NADH p  87.7    0.37   8E-06   30.6   1.6   25  183-207     5-30  (32)
 66 smart00064 FYVE Protein presen  87.7    0.25 5.5E-06   35.0   1.0   27  182-209    11-37  (68)
 67 TIGR00155 pqiA_fam integral me  87.3     1.8 3.9E-05   41.5   6.7   28  183-212   217-244 (403)
 68 COG4530 Uncharacterized protei  87.1     0.3 6.6E-06   41.0   1.2   32  182-215    10-41  (129)
 69 PF04423 Rad50_zn_hook:  Rad50   86.8    0.18 3.9E-06   35.2  -0.2   14  180-193    19-32  (54)
 70 PF01667 Ribosomal_S27e:  Ribos  86.8    0.48   1E-05   34.7   2.0   35  180-214     6-42  (55)
 71 PF14257 DUF4349:  Domain of un  86.3     2.9 6.3E-05   36.8   7.0   32   34-65    105-136 (262)
 72 PF02591 DUF164:  Putative zinc  86.0    0.45 9.9E-06   33.4   1.5   30  179-208    20-56  (56)
 73 PF09723 Zn-ribbon_8:  Zinc rib  86.0     0.4 8.7E-06   32.3   1.2   28  181-208     5-37  (42)
 74 COG1326 Uncharacterized archae  85.9     0.4 8.7E-06   43.1   1.5   29  180-208     5-40  (201)
 75 PF13453 zf-TFIIB:  Transcripti  85.8     0.5 1.1E-05   31.4   1.6   32  183-215     1-35  (41)
 76 PRK10220 hypothetical protein;  85.2    0.59 1.3E-05   38.7   2.0   28  182-209     4-31  (111)
 77 PTZ00083 40S ribosomal protein  84.4    0.69 1.5E-05   36.8   2.0   35  180-214    34-70  (85)
 78 COG3877 Uncharacterized protei  84.4    0.59 1.3E-05   39.1   1.7   28  182-215     7-34  (122)
 79 PLN00209 ribosomal protein S27  84.3    0.67 1.5E-05   36.9   1.9   35  180-214    35-71  (86)
 80 PRK13130 H/ACA RNA-protein com  84.1     0.5 1.1E-05   34.6   1.0   25  183-212     7-31  (56)
 81 PF09334 tRNA-synt_1g:  tRNA sy  84.1    0.52 1.1E-05   44.5   1.4   29  177-209   132-160 (391)
 82 PRK11827 hypothetical protein;  83.8    0.82 1.8E-05   34.0   2.0   32  182-213     9-41  (60)
 83 TIGR00340 zpr1_rel ZPR1-relate  83.8     0.6 1.3E-05   40.1   1.5   21  184-206     1-36  (163)
 84 PF10263 SprT-like:  SprT-like   83.4     0.8 1.7E-05   36.6   2.0   30  181-210   123-155 (157)
 85 PF13597 NRDD:  Anaerobic ribon  83.0    0.55 1.2E-05   46.5   1.1   45  163-211   465-518 (546)
 86 PF14446 Prok-RING_1:  Prokaryo  82.8    0.92   2E-05   33.2   2.0   30  178-208     2-31  (54)
 87 TIGR03831 YgiT_finger YgiT-typ  82.8    0.77 1.7E-05   29.8   1.4   11  199-209    33-43  (46)
 88 PF01927 Mut7-C:  Mut7-C RNAse   82.7     0.8 1.7E-05   37.6   1.8   35  180-215    90-140 (147)
 89 PRK14350 ligA NAD-dependent DN  82.6    0.48   1E-05   48.4   0.6   39  179-218   396-436 (669)
 90 PRK08271 anaerobic ribonucleos  82.1    0.75 1.6E-05   46.7   1.7   24  180-206   565-588 (623)
 91 KOG2593 Transcription initiati  82.0    0.63 1.4E-05   45.9   1.1   35  179-213   126-168 (436)
 92 PRK14704 anaerobic ribonucleos  82.0     0.7 1.5E-05   46.8   1.4   26  178-207   556-581 (618)
 93 PRK14714 DNA polymerase II lar  81.9    0.75 1.6E-05   50.5   1.7    9  182-190   668-676 (1337)
 94 PRK08402 replication factor A;  81.7    0.71 1.5E-05   43.9   1.3   30  177-206   208-238 (355)
 95 PRK03564 formate dehydrogenase  81.5       2 4.3E-05   40.5   4.1   10  181-190   187-196 (309)
 96 PRK09263 anaerobic ribonucleos  81.2    0.83 1.8E-05   46.9   1.7   25  180-206   640-667 (711)
 97 PRK07591 threonine synthase; V  81.1     1.1 2.3E-05   42.6   2.3   30  181-212    18-47  (421)
 98 PRK06450 threonine synthase; V  81.0    0.92   2E-05   42.0   1.8   30  180-211     2-31  (338)
 99 cd07973 Spt4 Transcription elo  80.8    0.85 1.8E-05   36.6   1.3   32  183-214     5-36  (98)
100 PF13719 zinc_ribbon_5:  zinc-r  80.6    0.87 1.9E-05   30.1   1.1   18  198-215     2-19  (37)
101 PF11781 RRN7:  RNA polymerase   80.6       1 2.3E-05   30.0   1.5   27  182-208     9-35  (36)
102 PRK07218 replication factor A;  80.3    0.84 1.8E-05   44.4   1.3   24  179-207   295-318 (423)
103 COG2824 PhnA Uncharacterized Z  80.2    0.96 2.1E-05   37.6   1.4   26  182-207     4-29  (112)
104 PRK04023 DNA polymerase II lar  80.0     0.9 1.9E-05   49.1   1.5   20  183-207   628-647 (1121)
105 PF14803 Nudix_N_2:  Nudix N-te  79.8     1.3 2.7E-05   29.5   1.6   24  184-207     3-31  (34)
106 PF05191 ADK_lid:  Adenylate ki  79.7     0.9   2E-05   30.3   0.9   30  183-212     3-35  (36)
107 TIGR02827 RNR_anaer_Bdell anae  79.4     1.1 2.3E-05   45.5   1.7   25  179-206   530-554 (586)
108 PRK06386 replication factor A;  79.1    0.99 2.1E-05   43.2   1.4   23  179-206   234-256 (358)
109 PRK06260 threonine synthase; V  79.0     1.4 3.1E-05   41.2   2.3   29  182-211     4-32  (397)
110 PRK07111 anaerobic ribonucleos  78.8     1.1 2.4E-05   46.1   1.7   22  181-206   680-701 (735)
111 cd04476 RPA1_DBD_C RPA1_DBD_C:  78.8     1.1 2.4E-05   36.7   1.4   33  178-210    31-63  (166)
112 PF14768 RPA_interact_C:  Repli  78.1       2 4.4E-05   32.6   2.5   27  184-213     2-28  (82)
113 COG1656 Uncharacterized conser  77.9     0.9 1.9E-05   39.7   0.7   36  179-215    95-146 (165)
114 PF14205 Cys_rich_KTR:  Cystein  77.9     1.9 4.1E-05   32.0   2.2   32  183-214     6-44  (55)
115 PRK08351 DNA-directed RNA poly  77.9     1.1 2.3E-05   33.6   0.9   22  182-208     4-25  (61)
116 cd00065 FYVE FYVE domain; Zinc  77.7     1.5 3.2E-05   29.8   1.6   28  182-210     3-30  (57)
117 smart00661 RPOL9 RNA polymeras  77.5     2.5 5.4E-05   28.4   2.6   31  183-213     2-35  (52)
118 COG0375 HybF Zn finger protein  77.5     1.5 3.2E-05   36.3   1.7   51  163-214    40-103 (115)
119 cd01407 SIR2-fam SIR2 family o  77.1     1.3 2.8E-05   38.1   1.4   32  178-209   106-144 (218)
120 PF13824 zf-Mss51:  Zinc-finger  76.5     1.6 3.4E-05   32.2   1.5   26  183-210     1-26  (55)
121 COG3357 Predicted transcriptio  76.1     1.3 2.8E-05   36.0   1.1   36  179-215    56-92  (97)
122 PRK14559 putative protein seri  76.0     1.5 3.2E-05   44.9   1.6    9  200-208    29-37  (645)
123 TIGR02487 NrdD anaerobic ribon  76.0     1.5 3.3E-05   43.7   1.8   41  164-207   500-547 (579)
124 PF08646 Rep_fac-A_C:  Replicat  75.5     1.4   3E-05   35.5   1.1   35  178-212    15-51  (146)
125 COG1405 SUA7 Transcription ini  75.3       2 4.4E-05   39.8   2.2   32  181-212     1-34  (285)
126 PRK15103 paraquat-inducible me  75.1     1.8 3.9E-05   41.7   1.9   27  183-212   223-249 (419)
127 TIGR01384 TFS_arch transcripti  75.0       2 4.3E-05   33.0   1.7   27  183-210     2-28  (104)
128 cd00730 rubredoxin Rubredoxin;  74.8     2.1 4.5E-05   30.5   1.7   25  183-207     3-43  (50)
129 PF15616 TerY-C:  TerY-C metal   74.7     3.2 6.8E-05   35.0   3.0   32  182-213    78-120 (131)
130 COG5349 Uncharacterized protei  74.5     1.3 2.8E-05   37.5   0.7   31  180-210    20-52  (126)
131 PF06044 DRP:  Dam-replacing fa  73.7     2.1 4.4E-05   39.8   1.8   34  182-215    32-72  (254)
132 PF14354 Lar_restr_allev:  Rest  73.7     2.2 4.7E-05   29.8   1.6   24  183-206     5-37  (61)
133 COG0272 Lig NAD-dependent DNA   73.5     1.4 3.1E-05   45.5   0.8   38  181-218   404-445 (667)
134 TIGR01053 LSD1 zinc finger dom  73.2     2.1 4.5E-05   28.0   1.3   17  198-214     1-17  (31)
135 PRK11823 DNA repair protein Ra  73.2     1.9 4.2E-05   41.4   1.6   27  182-211     8-34  (446)
136 PF04828 GFA:  Glutathione-depe  73.1     4.7  0.0001   28.7   3.2   25  188-212    38-62  (92)
137 PHA00626 hypothetical protein   73.0     2.6 5.6E-05   31.7   1.9   27  182-208     1-33  (59)
138 PRK15103 paraquat-inducible me  72.8     2.6 5.6E-05   40.7   2.4   31  183-213    12-45  (419)
139 PF08792 A2L_zn_ribbon:  A2L zi  72.6     2.9 6.4E-05   27.5   1.9   25  183-207     5-30  (33)
140 TIGR03830 CxxCG_CxxCG_HTH puta  72.6       2 4.4E-05   33.0   1.3   17  196-212    29-45  (127)
141 KOG4517 Uncharacterized conser  72.3     1.6 3.4E-05   36.5   0.7   15  194-208   102-116 (117)
142 cd01675 RNR_III Class III ribo  72.2     2.1 4.5E-05   42.5   1.6   23  182-207   519-541 (555)
143 TIGR00416 sms DNA repair prote  72.1     2.1 4.5E-05   41.4   1.6   26  182-210     8-33  (454)
144 PF03119 DNA_ligase_ZBD:  NAD-d  71.8     2.6 5.7E-05   26.7   1.5   15  200-214     1-15  (28)
145 PF13005 zf-IS66:  zinc-finger   71.8     3.1 6.8E-05   27.7   1.9   10  200-209     4-13  (47)
146 COG1996 RPC10 DNA-directed RNA  71.7       3 6.5E-05   30.1   1.9   32  182-213     7-39  (49)
147 TIGR03826 YvyF flagellar opero  71.3     1.2 2.5E-05   37.6  -0.3   24  182-207     4-27  (137)
148 COG1675 TFA1 Transcription ini  71.2     1.2 2.6E-05   39.0  -0.2   31  182-212   114-146 (176)
149 PF15135 UPF0515:  Uncharacteri  71.2     1.7 3.8E-05   40.7   0.8   31  179-209   153-185 (278)
150 PRK14351 ligA NAD-dependent DN  70.9    0.99 2.1E-05   46.3  -0.9   37  181-218   423-462 (689)
151 TIGR00398 metG methionyl-tRNA   70.9       2 4.4E-05   41.2   1.2   26  179-208   134-159 (530)
152 smart00440 ZnF_C2C2 C2C2 Zinc   70.8     2.2 4.7E-05   28.7   1.0   17  183-199     2-18  (40)
153 PRK14714 DNA polymerase II lar  70.8     2.1 4.5E-05   47.3   1.3   26  180-209   678-703 (1337)
154 PF10013 DUF2256:  Uncharacteri  70.4       2 4.4E-05   30.2   0.8   17  176-192     3-19  (42)
155 PF11241 DUF3043:  Protein of u  70.2      77  0.0017   27.9  11.0   55   92-146    29-89  (170)
156 PRK00133 metG methionyl-tRNA s  70.1       2 4.4E-05   43.1   1.0   25  179-208   137-162 (673)
157 PRK08115 ribonucleotide-diphos  70.0       2 4.4E-05   45.4   1.1   29  181-209   827-855 (858)
158 KOG1247 Methionyl-tRNA synthet  69.9     1.5 3.2E-05   44.2   0.0   32  173-208   144-175 (567)
159 PRK14559 putative protein seri  69.9     2.2 4.7E-05   43.7   1.2   25  182-209    28-52  (645)
160 PHA00732 hypothetical protein   69.4       4 8.6E-05   31.2   2.3   33  183-215     3-44  (79)
161 KOG2907 RNA polymerase I trans  69.1     2.1 4.5E-05   35.8   0.7   31  177-207    70-111 (116)
162 PF13451 zf-trcl:  Probable zin  69.0     1.2 2.6E-05   32.0  -0.6   27  181-207     4-42  (49)
163 cd01410 SIRT7 SIRT7: Eukaryoti  69.0       3 6.5E-05   36.1   1.7   31  178-208    92-130 (206)
164 TIGR00155 pqiA_fam integral me  68.9     3.5 7.6E-05   39.6   2.3   29  183-211    15-46  (403)
165 COG0143 MetG Methionyl-tRNA sy  68.9     2.3 4.9E-05   42.9   1.1   36  173-212   134-169 (558)
166 PRK12366 replication factor A;  68.6     2.3 5.1E-05   42.9   1.1   31  176-207   527-557 (637)
167 PRK14892 putative transcriptio  68.5     3.3 7.1E-05   33.3   1.7   25  183-207    23-51  (99)
168 PF09332 Mcm10:  Mcm10 replicat  68.5     2.2 4.7E-05   40.8   0.8   33  183-215   287-320 (344)
169 cd01413 SIR2_Af2 SIR2_Af2: Arc  68.3     2.7 5.8E-05   36.6   1.3   33  177-209   109-147 (222)
170 PF12677 DUF3797:  Domain of un  68.2       4 8.6E-05   29.7   1.9   26  181-215    13-38  (49)
171 COG1779 C4-type Zn-finger prot  68.2     2.4 5.3E-05   38.2   1.0   27  180-206    13-51  (201)
172 TIGR01031 rpmF_bact ribosomal   67.9     3.5 7.7E-05   29.7   1.6   18  184-205    29-46  (55)
173 PF03367 zf-ZPR1:  ZPR1 zinc-fi  67.7     2.1 4.6E-05   36.3   0.5   26  181-206     1-38  (161)
174 PF01783 Ribosomal_L32p:  Ribos  67.6       3 6.5E-05   29.8   1.2   20  182-205    27-46  (56)
175 COG1655 Uncharacterized protei  67.6     2.3   5E-05   39.7   0.8   12  181-192    19-30  (267)
176 smart00532 LIGANc Ligase N fam  67.5     1.7 3.8E-05   42.3  -0.0   38  180-217   398-438 (441)
177 TIGR00570 cdk7 CDK-activating   67.4     3.2 6.9E-05   39.4   1.7   18  195-212    40-57  (309)
178 COG3809 Uncharacterized protei  67.3     2.9 6.2E-05   33.4   1.2   31  183-214     3-36  (88)
179 PF01096 TFIIS_C:  Transcriptio  67.1     2.1 4.6E-05   28.6   0.3   12  184-195     3-14  (39)
180 KOG2906 RNA polymerase III sub  67.0     3.5 7.6E-05   34.0   1.6   16  199-214     2-17  (105)
181 COG4888 Uncharacterized Zn rib  66.9     3.1 6.8E-05   34.2   1.3   31  182-212    23-60  (104)
182 PRK14138 NAD-dependent deacety  66.8       3 6.5E-05   37.1   1.3   32  178-209   116-154 (244)
183 PRK09521 exosome complex RNA-b  66.7     3.4 7.4E-05   35.1   1.6   29  179-207   147-175 (189)
184 PF05876 Terminase_GpA:  Phage   66.6     3.6 7.8E-05   40.8   2.0   30  181-210   200-241 (557)
185 PF02150 RNA_POL_M_15KD:  RNA p  66.5     2.8 6.1E-05   27.6   0.8   16  199-214     2-17  (35)
186 PRK06319 DNA topoisomerase I/S  66.1     4.6 9.9E-05   42.3   2.7   16  200-215   647-662 (860)
187 PRK00241 nudC NADH pyrophospha  65.9     4.2 9.1E-05   36.6   2.1   28  181-208    99-127 (256)
188 PRK07956 ligA NAD-dependent DN  65.9     1.7 3.7E-05   44.3  -0.5   40  180-219   403-446 (665)
189 PF08996 zf-DNA_Pol:  DNA Polym  65.7     2.9 6.3E-05   35.8   1.0   27  182-208    19-55  (188)
190 COG1040 ComFC Predicted amidop  65.3       2 4.3E-05   38.0  -0.1   27  182-211    25-51  (225)
191 PF14255 Cys_rich_CPXG:  Cystei  64.9     3.7   8E-05   29.6   1.2   16  199-214     1-16  (52)
192 cd01412 SIRT5_Af1_CobB SIRT5_A  64.7     4.1 8.8E-05   35.1   1.7   33  177-209   105-141 (224)
193 PF06170 DUF983:  Protein of un  64.4     3.4 7.3E-05   32.2   1.0   24  191-214     1-24  (86)
194 PRK12286 rpmF 50S ribosomal pr  64.0     4.9 0.00011   29.3   1.7   19  183-205    29-47  (57)
195 TIGR00375 conserved hypothetic  63.7     3.2 6.9E-05   40.0   0.9   28  181-210   240-270 (374)
196 PF01396 zf-C4_Topoisom:  Topoi  63.6     4.6  0.0001   27.0   1.4   17  199-215     2-18  (39)
197 PRK04011 peptide chain release  63.5     3.6 7.9E-05   39.5   1.3   33  180-212   327-364 (411)
198 PF08209 Sgf11:  Sgf11 (transcr  63.4     5.5 0.00012   26.5   1.8   14  196-209     2-15  (33)
199 PRK11088 rrmA 23S rRNA methylt  63.3     4.6 9.9E-05   35.4   1.8   24  183-207     4-27  (272)
200 PRK04023 DNA polymerase II lar  63.2     4.1   9E-05   44.3   1.7   27  179-209   636-662 (1121)
201 COG1867 TRM1 N2,N2-dimethylgua  62.8     3.8 8.2E-05   40.0   1.3   25  182-206   241-265 (380)
202 COG4311 SoxD Sarcosine oxidase  62.6     4.1 8.8E-05   33.2   1.2   33  198-234     3-35  (97)
203 PF14353 CpXC:  CpXC protein     62.6     4.3 9.4E-05   32.1   1.4   14  198-211     1-14  (128)
204 PRK07217 replication factor A;  62.5     3.9 8.4E-05   38.9   1.3   21  182-207   189-211 (311)
205 PF02146 SIR2:  Sir2 family;  I  61.9       3 6.5E-05   34.6   0.4   29  181-209   105-140 (178)
206 TIGR00595 priA primosomal prot  61.7     5.7 0.00012   38.9   2.3   11  199-209   254-264 (505)
207 COG2093 DNA-directed RNA polym  61.5     3.9 8.5E-05   31.1   0.9   22  183-207     6-27  (64)
208 COG2835 Uncharacterized conser  61.3     6.8 0.00015   29.4   2.1   33  182-214     9-42  (60)
209 TIGR00630 uvra excinuclease AB  61.1     5.2 0.00011   42.5   2.0   31  181-211   250-290 (924)
210 PF10601 zf-LITAF-like:  LITAF-  61.1      15 0.00033   26.7   3.9   19  192-210    52-70  (73)
211 PF04475 DUF555:  Protein of un  61.1     4.1 8.9E-05   33.4   1.0   22  188-209    37-58  (102)
212 PRK05580 primosome assembly pr  60.5       6 0.00013   40.0   2.3   14  198-211   421-434 (679)
213 PF00628 PHD:  PHD-finger;  Int  60.4     9.4  0.0002   25.4   2.5   23  184-208     2-24  (51)
214 PRK00481 NAD-dependent deacety  60.3     4.8  0.0001   35.3   1.4   34  176-209   117-153 (242)
215 PF12861 zf-Apc11:  Anaphase-pr  59.9     6.1 0.00013   31.3   1.7   14  197-210    70-83  (85)
216 COG2176 PolC DNA polymerase II  59.5     5.4 0.00012   44.3   1.8   33  181-214   914-954 (1444)
217 TIGR00577 fpg formamidopyrimid  59.5     5.6 0.00012   35.9   1.7   22  183-205   247-272 (272)
218 TIGR00354 polC DNA polymerase,  59.3     4.6 9.9E-05   43.9   1.2   22  182-208   626-647 (1095)
219 PF05605 zf-Di19:  Drought indu  59.2     6.7 0.00014   27.2   1.7   26  182-207     3-40  (54)
220 smart00709 Zpr1 Duplicated dom  59.1     5.3 0.00011   34.1   1.4    8  183-190     2-9   (160)
221 COG1579 Zn-ribbon protein, pos  59.1       3 6.5E-05   38.1  -0.1   36  180-215   196-238 (239)
222 PRK08197 threonine synthase; V  59.0     6.5 0.00014   36.8   2.1   31  181-213     7-37  (394)
223 TIGR01206 lysW lysine biosynth  59.0     5.8 0.00012   28.8   1.4   16  198-213     2-17  (54)
224 PF06750 DiS_P_DiS:  Bacterial   58.3      17 0.00037   28.3   4.0   42  168-209    12-69  (92)
225 PRK00464 nrdR transcriptional   57.8     3.8 8.2E-05   35.0   0.3   24  176-199    21-46  (154)
226 PF05180 zf-DNL:  DNL zinc fing  57.8     2.8   6E-05   31.7  -0.4   33  180-212     3-43  (66)
227 COG1198 PriA Primosomal protei  57.8     6.7 0.00015   40.9   2.1   16  197-212   474-489 (730)
228 PLN02569 threonine synthase     57.6     7.5 0.00016   38.2   2.3   29  182-212    50-78  (484)
229 PF00130 C1_1:  Phorbol esters/  57.5      10 0.00022   25.5   2.3   29  180-208    10-38  (53)
230 PF14206 Cys_rich_CPCC:  Cystei  57.5     6.9 0.00015   30.4   1.7   30  182-214     2-33  (78)
231 COG1110 Reverse gyrase [DNA re  56.9     4.4 9.5E-05   44.3   0.7   22  183-207   696-717 (1187)
232 PF02318 FYVE_2:  FYVE-type zin  56.3     9.2  0.0002   30.5   2.3   34  180-213    53-86  (118)
233 PRK08665 ribonucleotide-diphos  56.2      11 0.00023   39.3   3.2   22  183-205   726-747 (752)
234 cd01411 SIR2H SIR2H: Uncharact  56.0     6.2 0.00014   34.5   1.4   32  178-209   115-147 (225)
235 PRK06393 rpoE DNA-directed RNA  55.9     4.9 0.00011   30.4   0.6   22  181-207     5-26  (64)
236 COG2816 NPY1 NTP pyrophosphohy  55.6     7.6 0.00017   36.4   1.9   32  173-207   106-138 (279)
237 PF04216 FdhE:  Protein involve  55.4     5.6 0.00012   35.8   1.0   10  181-190   172-181 (290)
238 PRK07561 DNA topoisomerase I s  55.0     9.6 0.00021   39.9   2.7   16  200-215   647-662 (859)
239 COG1066 Sms Predicted ATP-depe  54.7      11 0.00024   37.7   2.9   22  182-206     8-29  (456)
240 TIGR00515 accD acetyl-CoA carb  54.3     4.6 9.9E-05   37.4   0.3   28  183-210    28-57  (285)
241 COG1594 RPB9 DNA-directed RNA   54.1     6.3 0.00014   31.9   1.0   26  182-207    73-109 (113)
242 COG1327 Predicted transcriptio  54.0     7.6 0.00017   33.9   1.5   25  182-206     1-36  (156)
243 COG1503 eRF1 Peptide chain rel  53.8     6.6 0.00014   38.7   1.2   32  180-211   326-361 (411)
244 PF07503 zf-HYPF:  HypF finger;  53.6     2.4 5.2E-05   28.3  -1.3   28  184-211     2-34  (35)
245 smart00714 LITAF Possible memb  53.3      45 0.00098   23.9   5.2   19  192-210    46-64  (67)
246 COG4338 Uncharacterized protei  53.3       4 8.6E-05   30.1  -0.3   15  178-192     9-23  (54)
247 COG1198 PriA Primosomal protei  53.2     8.8 0.00019   40.1   2.1   25  181-213   435-459 (730)
248 PRK14973 DNA topoisomerase I;   53.1      10 0.00022   40.4   2.6   16  200-215   637-654 (936)
249 PF03563 Bunya_G2:  Bunyavirus   52.8      52  0.0011   31.3   6.8   55  140-196   189-249 (285)
250 COG1439 Predicted nucleic acid  52.7     7.9 0.00017   34.3   1.5   30  182-214   140-169 (177)
251 PF08882 Acetone_carb_G:  Aceto  52.6      13 0.00027   31.0   2.5   27  199-237    75-101 (112)
252 PF04216 FdhE:  Protein involve  52.3     4.5 9.7E-05   36.4  -0.1   24  183-209   199-222 (290)
253 PHA02998 RNA polymerase subuni  52.3     8.2 0.00018   34.8   1.5   33  180-212   142-185 (195)
254 PRK04179 rpl37e 50S ribosomal   52.3     6.5 0.00014   29.8   0.7   25  180-206    16-40  (62)
255 PLN03121 nucleic acid binding   52.2      19 0.00041   33.3   3.9   49   66-118   153-201 (243)
256 PLN02610 probable methionyl-tR  52.1     5.5 0.00012   41.6   0.4   30  175-208   149-180 (801)
257 cd01409 SIRT4 SIRT4: Eukaryoti  52.0     7.8 0.00017   34.8   1.3   15  178-192   115-129 (260)
258 PF13913 zf-C2HC_2:  zinc-finge  51.9     6.6 0.00014   24.0   0.6    9  183-191     4-12  (25)
259 TIGR00575 dnlj DNA ligase, NAD  51.9     4.5 9.7E-05   41.2  -0.2   40  180-219   391-433 (652)
260 COG3677 Transposase and inacti  51.8      22 0.00049   29.3   3.9   42  173-214    21-69  (129)
261 PF04606 Ogr_Delta:  Ogr/Delta-  51.8     8.8 0.00019   26.3   1.3   25  183-207     1-36  (47)
262 PRK11463 fxsA phage T7 F exclu  51.7      71  0.0015   26.9   6.9   31  142-172    78-109 (148)
263 PF09889 DUF2116:  Uncharacteri  51.7     6.3 0.00014   29.2   0.6   11  200-210     5-15  (59)
264 PF12279 DUF3619:  Protein of u  51.5      76  0.0017   26.6   7.0   30   67-96      7-41  (131)
265 PF11023 DUF2614:  Protein of u  51.3     7.1 0.00015   32.6   0.9   19  192-210    63-81  (114)
266 cd00029 C1 Protein kinase C co  51.2     8.3 0.00018   25.0   1.1   27  182-208    12-38  (50)
267 PRK10445 endonuclease VIII; Pr  51.0     9.6 0.00021   34.3   1.8   23  182-205   236-262 (263)
268 cd01408 SIRT1 SIRT1: Eukaryoti  50.9     8.6 0.00019   33.9   1.4   34  176-209   111-151 (235)
269 COG4469 CoiA Competence protei  50.8     8.3 0.00018   37.3   1.4   16  199-214    26-41  (342)
270 PF12760 Zn_Tnp_IS1595:  Transp  50.6      12 0.00026   25.3   1.8   24  183-206    20-45  (46)
271 KOG3966 p53-mediated apoptosis  50.4 1.9E+02   0.004   28.3  10.2   52   61-113    18-69  (360)
272 COG1571 Predicted DNA-binding   50.3     8.4 0.00018   38.1   1.3   29  180-208   349-377 (421)
273 COG4481 Uncharacterized protei  50.2     6.8 0.00015   29.5   0.6   18  198-215    34-51  (60)
274 PRK08332 ribonucleotide-diphos  50.1      13 0.00027   42.5   2.8   35  172-206  1695-1734(1740)
275 PRK05333 NAD-dependent deacety  50.0     8.2 0.00018   34.9   1.2   12  198-209   179-190 (285)
276 TIGR03847 conserved hypothetic  49.9     7.5 0.00016   34.6   0.9   16  199-215   157-172 (177)
277 PRK07561 DNA topoisomerase I s  49.7      19 0.00041   37.7   3.9   18  198-215   766-783 (859)
278 COG5525 Bacteriophage tail ass  49.0     9.7 0.00021   39.3   1.6   28  183-210   229-271 (611)
279 KOG3096 Spliceosome-associated  48.6      74  0.0016   29.4   6.9   53   51-103   127-180 (225)
280 PRK14810 formamidopyrimidine-D  48.5     9.6 0.00021   34.5   1.4   23  183-205   246-271 (272)
281 PF00301 Rubredoxin:  Rubredoxi  48.3     8.2 0.00018   27.2   0.7   14  183-196     3-16  (47)
282 PRK01103 formamidopyrimidine/5  48.2      10 0.00022   34.2   1.5   23  183-206   247-273 (274)
283 PF13639 zf-RING_2:  Ring finge  48.2      11 0.00023   24.7   1.2   24  182-207     1-24  (44)
284 PF14311 DUF4379:  Domain of un  48.1     8.5 0.00018   26.8   0.8   25  180-204    27-55  (55)
285 PF06906 DUF1272:  Protein of u  47.9       8 0.00017   28.9   0.6   12  198-209    41-52  (57)
286 COG1328 NrdD Oxygen-sensitive   47.8     9.6 0.00021   39.7   1.4   24  181-207   641-664 (700)
287 PF13894 zf-C2H2_4:  C2H2-type   47.7     6.8 0.00015   21.5   0.2   12  183-194     2-13  (24)
288 COG2991 Uncharacterized protei  47.3      21 0.00045   28.1   2.8   24  162-185    11-34  (77)
289 KOG3134 Predicted membrane pro  47.2     6.5 0.00014   36.1   0.1   14  195-208    21-34  (225)
290 PRK03922 hypothetical protein;  47.0     8.5 0.00018   32.1   0.7   18  191-208    42-59  (113)
291 COG3058 FdhE Uncharacterized p  46.9      39 0.00084   32.4   5.1   10  198-207   225-234 (308)
292 PF06054 CoiA:  Competence prot  46.9      12 0.00027   35.4   1.9   19  196-214    28-46  (375)
293 TIGR00308 TRM1 tRNA(guanine-26  46.8      11 0.00024   35.9   1.6   30  181-210   233-264 (374)
294 smart00647 IBR In Between Ring  46.7      27 0.00059   23.6   3.1   25  183-207    20-49  (64)
295 smart00109 C1 Protein kinase C  46.4      12 0.00026   23.9   1.2   26  181-207    11-36  (49)
296 PF09862 DUF2089:  Protein of u  46.3      10 0.00023   31.2   1.1   14  201-214     1-14  (113)
297 PRK02935 hypothetical protein;  45.8     8.6 0.00019   32.0   0.6   19  194-212    66-84  (110)
298 KOG1779 40s ribosomal protein   45.8      15 0.00033   29.3   1.9   34  181-214    34-69  (84)
299 PF12653 DUF3785:  Protein of u  45.6     9.8 0.00021   32.7   0.9   12  197-208   119-130 (138)
300 PF12273 RCR:  Chitin synthesis  45.4      27  0.0006   28.0   3.4   29  165-193    13-41  (130)
301 KOG4218 Nuclear hormone recept  45.0     9.4  0.0002   37.8   0.8   29  178-206    12-40  (475)
302 COG5257 GCD11 Translation init  44.9      12 0.00026   36.9   1.4   28  182-211    58-85  (415)
303 cd00296 SIR2 SIR2 superfamily   44.6      11 0.00024   31.7   1.1   39  177-215   109-151 (222)
304 PF03833 PolC_DP2:  DNA polymer  44.6     7.3 0.00016   41.7   0.0   28  182-209   656-691 (900)
305 PRK14715 DNA polymerase II lar  44.6      11 0.00024   42.5   1.3   22  181-207   674-695 (1627)
306 PF12172 DUF35_N:  Rubredoxin-l  44.5     7.8 0.00017   25.0   0.1   25  178-205     8-32  (37)
307 PF10083 DUF2321:  Uncharacteri  44.3     3.7 7.9E-05   35.9  -1.9   25  178-208    25-49  (158)
308 PRK09678 DNA-binding transcrip  43.8      16 0.00034   28.0   1.7   29  182-210     2-41  (72)
309 TIGR02745 ccoG_rdxA_fixG cytoc  43.7      37 0.00081   33.3   4.6   18  173-190   177-194 (434)
310 PF10122 Mu-like_Com:  Mu-like   43.7      12 0.00026   27.4   1.0   35  180-214     3-40  (51)
311 PRK05452 anaerobic nitric oxid  43.6      11 0.00024   36.7   1.0   25  183-207   427-467 (479)
312 PF04641 Rtf2:  Rtf2 RING-finge  42.9      14  0.0003   33.1   1.5   13  181-193   113-125 (260)
313 PF01004 Flavi_M:  Flavivirus e  42.9      31 0.00068   26.7   3.2   31  131-161    37-67  (75)
314 PF04267 SoxD:  Sarcosine oxida  42.8     5.4 0.00012   31.4  -1.0   31  199-233     2-32  (84)
315 PRK04338 N(2),N(2)-dimethylgua  42.5      13 0.00029   35.3   1.4   30  181-210   244-273 (382)
316 PF14159 CAAD:  CAAD domains of  42.3      62  0.0013   25.3   4.8   43  139-181    21-70  (90)
317 PRK10246 exonuclease subunit S  42.1      12 0.00027   39.7   1.2   16  175-190   496-512 (1047)
318 PRK14811 formamidopyrimidine-D  42.0      14  0.0003   33.5   1.3   23  183-206   237-263 (269)
319 PF08772 NOB1_Zn_bind:  Nin one  41.7      12 0.00027   28.6   0.9   23  183-207    11-33  (73)
320 PF02005 TRM:  N2,N2-dimethylgu  41.4      14 0.00029   35.4   1.2   30  181-210   240-271 (377)
321 PTZ00410 NAD-dependent SIR2; P  41.2      14 0.00029   35.5   1.2   33  177-209   143-182 (349)
322 PTZ00043 cytochrome c oxidase   41.0      20 0.00044   33.6   2.2   43  191-235   174-216 (268)
323 TIGR03676 aRF1/eRF1 peptide ch  41.0      15 0.00032   35.5   1.4   32  180-211   319-355 (403)
324 COG4260 Membrane protease subu  40.9      11 0.00024   36.3   0.6   20   22-41    127-146 (345)
325 PRK07219 DNA topoisomerase I;   40.9      23 0.00049   37.0   2.8   19  197-215   687-705 (822)
326 COG0846 SIR2 NAD-dependent pro  40.7      11 0.00024   34.4   0.5   30  177-206   118-154 (250)
327 smart00734 ZnF_Rad18 Rad18-lik  40.7      13 0.00028   23.1   0.7    9  183-191     3-11  (26)
328 COG0498 ThrC Threonine synthas  40.4      11 0.00023   36.8   0.4   33  179-212     3-35  (411)
329 smart00350 MCM minichromosome   40.4      32  0.0007   33.5   3.7   25  182-206    38-69  (509)
330 PRK01345 heat shock protein Ht  40.4      90   0.002   29.0   6.4   32  145-176    16-48  (317)
331 PF04906 Tweety:  Tweety;  Inte  40.0      76  0.0016   30.6   6.0   77   37-113    89-169 (406)
332 PF05478 Prominin:  Prominin;    40.0 4.6E+02    0.01   27.4  15.7   47   53-101   337-383 (806)
333 PF08285 DPM3:  Dolichol-phosph  39.5      67  0.0015   25.4   4.7   50  139-188    12-70  (91)
334 PRK14873 primosome assembly pr  39.5      17 0.00037   37.3   1.7   24  183-206   394-418 (665)
335 PRK13945 formamidopyrimidine-D  39.4      17 0.00037   33.0   1.5   10  130-139   176-185 (282)
336 PF03833 PolC_DP2:  DNA polymer  38.9      10 0.00022   40.7   0.0   30  180-209   666-703 (900)
337 smart00355 ZnF_C2H2 zinc finge  38.7      16 0.00034   19.9   0.8   12  183-194     2-13  (26)
338 PRK08173 DNA topoisomerase III  38.7      18  0.0004   38.1   1.8   27  182-209   625-651 (862)
339 PRK02224 chromosome segregatio  38.7      17 0.00037   36.9   1.5   18  176-193   446-463 (880)
340 TIGR00595 priA primosomal prot  38.6      18 0.00039   35.5   1.7   28  184-211   225-253 (505)
341 PF10058 DUF2296:  Predicted in  38.2      21 0.00046   25.7   1.5   23  184-206    25-52  (54)
342 smart00778 Prim_Zn_Ribbon Zinc  38.0      26 0.00056   23.8   1.8   24  181-205     3-32  (37)
343 PRK10996 thioredoxin 2; Provis  38.0      20 0.00043   28.7   1.6   28  182-209     3-33  (139)
344 PF14319 Zn_Tnp_IS91:  Transpos  37.8      16 0.00036   29.2   1.0   28  180-207    41-69  (111)
345 smart00504 Ubox Modified RING   37.6      29 0.00063   23.5   2.1   11  181-191    35-45  (63)
346 KOG2927 Membrane component of   37.2      10 0.00023   37.0  -0.2   34  111-144   202-235 (372)
347 TIGR01374 soxD sarcosine oxida  37.1      18  0.0004   28.6   1.2   31  199-233     2-32  (84)
348 PRK14894 glycyl-tRNA synthetas  37.1      20 0.00042   36.7   1.6   25  181-206    88-112 (539)
349 PRK00349 uvrA excinuclease ABC  37.1      19 0.00042   38.5   1.7   30  183-212   254-293 (943)
350 PF13465 zf-H2C2_2:  Zinc-finge  37.0      10 0.00023   22.9  -0.2   10  183-192    16-25  (26)
351 PRK00420 hypothetical protein;  36.6      19 0.00041   29.6   1.2   24  192-215    17-41  (112)
352 KOG1307 K+-dependent Ca2+/Na+   36.5      56  0.0012   33.6   4.7   57  129-187   525-587 (588)
353 COG4965 TadB Flp pilus assembl  36.3 3.3E+02  0.0071   26.2   9.4   18  104-121    53-70  (309)
354 PTZ00409 Sir2 (Silent Informat  36.1      19 0.00042   32.8   1.3   31  178-209   134-175 (271)
355 TIGR01385 TFSII transcription   36.0      18 0.00039   33.8   1.2   26  182-207   259-295 (299)
356 PF09925 DUF2157:  Predicted me  35.9 2.3E+02   0.005   22.9   7.4   45  133-177    38-84  (145)
357 PRK00418 DNA gyrase inhibitor;  35.9      19 0.00041   27.1   1.0   19  197-215     5-24  (62)
358 CHL00174 accD acetyl-CoA carbo  35.8      13 0.00028   35.0   0.2   29  183-211    40-70  (296)
359 PRK11788 tetratricopeptide rep  35.1      24 0.00052   30.9   1.7   22  183-207   356-377 (389)
360 PF08507 COPI_assoc:  COPI asso  35.1 1.5E+02  0.0033   23.9   6.2   38  119-157    54-91  (136)
361 PF05280 FlhC:  Flagellar trans  35.1      22 0.00047   30.9   1.4   28  179-206   132-162 (175)
362 COG0178 UvrA Excinuclease ATPa  35.0      21 0.00045   38.6   1.5   26  181-206   245-277 (935)
363 PF13994 PgaD:  PgaD-like prote  34.9 1.6E+02  0.0034   24.1   6.4   28  114-143     4-31  (138)
364 PRK08382 putative monovalent c  34.8      93   0.002   27.8   5.3   57  173-239   103-162 (201)
365 PF10080 DUF2318:  Predicted me  34.6      23  0.0005   28.5   1.4   34  179-212    33-66  (102)
366 PTZ00303 phosphatidylinositol   34.6      19 0.00042   39.1   1.2   40  174-213   453-496 (1374)
367 COG1379 PHP family phosphoeste  34.5      11 0.00023   37.1  -0.6   30  182-213   247-278 (403)
368 PTZ00408 NAD-dependent deacety  34.4      16 0.00034   32.7   0.5   30  177-206   113-145 (242)
369 PF01485 IBR:  IBR domain;  Int  34.2      25 0.00054   23.7   1.4   25  183-207    20-49  (64)
370 TIGR00319 desulf_FeS4 desulfof  34.2      38 0.00083   21.5   2.1   18  196-213     5-22  (34)
371 COG0419 SbcC ATPase involved i  33.9      20 0.00043   37.3   1.1   16  180-195   456-471 (908)
372 COG3813 Uncharacterized protei  33.9      20 0.00043   28.5   0.9   12  180-191    40-51  (84)
373 PF03884 DUF329:  Domain of unk  33.8      28 0.00062   25.6   1.7   12  199-210     3-14  (57)
374 PRK09401 reverse gyrase; Revie  33.7      18  0.0004   39.4   0.9   26  180-208   677-702 (1176)
375 COG3898 Uncharacterized membra  33.7 1.1E+02  0.0024   31.2   6.1   33  150-182    34-68  (531)
376 PF09334 tRNA-synt_1g:  tRNA sy  33.7      25 0.00055   33.4   1.7   10   14-23     10-19  (391)
377 KOG1729 FYVE finger containing  33.6     9.6 0.00021   35.7  -1.0   31  181-211   168-198 (288)
378 PF09845 DUF2072:  Zn-ribbon co  33.5      23 0.00049   30.2   1.2   28  183-210     3-31  (131)
379 KOG1819 FYVE finger-containing  33.4      13 0.00027   38.7  -0.3   25  183-208   903-927 (990)
380 PF11833 DUF3353:  Protein of u  33.3 3.3E+02  0.0071   24.0   8.4   72   66-139     8-95  (194)
381 PF00096 zf-C2H2:  Zinc finger,  33.2      14  0.0003   20.9  -0.0   11  183-193     2-12  (23)
382 PF09972 DUF2207:  Predicted me  32.8 2.1E+02  0.0046   26.3   7.5   12   59-70    330-341 (511)
383 PF11331 DUF3133:  Protein of u  32.8      30 0.00065   24.6   1.6   19  193-211    26-44  (46)
384 PLN03121 nucleic acid binding   32.7      42 0.00092   31.1   2.9   41   65-112   135-175 (243)
385 COG1998 RPS31 Ribosomal protei  32.6      38 0.00083   24.9   2.1   29  183-211    21-50  (51)
386 PF06827 zf-FPG_IleRS:  Zinc fi  32.6      23 0.00051   21.9   0.9   24  183-206     3-29  (30)
387 PF07191 zinc-ribbons_6:  zinc-  32.4      26 0.00057   27.0   1.3   17  199-215     2-18  (70)
388 PF05129 Elf1:  Transcription e  32.4      34 0.00075   26.3   2.0   32  181-212    22-60  (81)
389 PF11290 DUF3090:  Protein of u  32.4      20 0.00042   31.7   0.7   15  200-215   156-170 (171)
390 TIGR01597 PYST-B Plasmodium yo  32.4 1.1E+02  0.0024   28.7   5.6   47  122-175   193-239 (255)
391 PHA02768 hypothetical protein;  32.2      22 0.00048   26.1   0.9   28  180-207     4-40  (55)
392 PF10367 Vps39_2:  Vacuolar sor  32.1      34 0.00073   25.2   1.9   20  182-203    79-98  (109)
393 smart00837 DPBB_1 Rare lipopro  32.0      21 0.00045   27.6   0.7    9  229-237    79-87  (87)
394 PRK01741 cell division protein  31.8      34 0.00075   33.0   2.3   25  153-177     3-27  (332)
395 PF06364 DUF1068:  Protein of u  31.6      41 0.00089   30.0   2.6   38  165-214    23-63  (176)
396 PF04674 Phi_1:  Phosphate-indu  31.5      29 0.00063   32.6   1.7   34  176-209   114-162 (273)
397 smart00132 LIM Zinc-binding do  31.4      28  0.0006   21.0   1.1   11  183-193     1-11  (39)
398 PTZ00396 Casein kinase II subu  31.3      31 0.00067   31.9   1.8   34  179-212   118-162 (251)
399 TIGR00108 eRF peptide chain re  31.0      26 0.00056   33.8   1.3   31  180-210   323-358 (409)
400 PRK01110 rpmF 50S ribosomal pr  30.8      29 0.00062   25.5   1.3   12  198-209    27-38  (60)
401 PRK11032 hypothetical protein;  30.6      26 0.00057   30.4   1.2   26  182-207   125-151 (160)
402 PRK00635 excinuclease ABC subu  30.5      28 0.00061   40.0   1.7   31  180-210   243-283 (1809)
403 PF12273 RCR:  Chitin synthesis  30.4      44 0.00095   26.9   2.4   22  151-172     2-23  (130)
404 PF06107 DUF951:  Bacterial pro  30.4      21 0.00045   26.6   0.5   18  198-215    31-48  (57)
405 PRK06599 DNA topoisomerase I;   30.2      41  0.0009   34.2   2.7   16  200-215   639-654 (675)
406 cd00974 DSRD Desulforedoxin (D  30.0      49  0.0011   21.1   2.1   18  196-213     2-19  (34)
407 PRK14282 chaperone protein Dna  30.0      49  0.0011   31.1   2.9   13  193-205   190-202 (369)
408 PRK12722 transcriptional activ  29.6      54  0.0012   29.2   3.0   40  167-206   120-162 (187)
409 PF05473 Herpes_UL45:  UL45 pro  29.6 1.2E+02  0.0027   26.7   5.2   15  183-197    81-95  (200)
410 PF05766 NinG:  Bacteriophage L  29.6      21 0.00046   31.7   0.5   28  181-208     6-34  (189)
411 PRK03072 heat shock protein Ht  29.4 1.9E+02  0.0041   26.4   6.5   36  144-180    19-55  (288)
412 PRK12336 translation initiatio  29.4      62  0.0013   28.4   3.3   33  182-214    99-135 (201)
413 PLN00193 expansin-A; Provision  29.3      31 0.00068   31.9   1.5   10  229-238   145-154 (256)
414 PF04438 zf-HIT:  HIT zinc fing  29.3      31 0.00067   22.2   1.1   21  182-208     3-23  (30)
415 PF06221 zf-C2HC5:  Putative zi  29.3      32 0.00069   25.4   1.3   28  182-209    19-46  (57)
416 PLN03024 Putative EG45-like do  29.1      22 0.00048   29.4   0.5   10  229-238   115-124 (125)
417 KOG3507 DNA-directed RNA polym  28.9      31 0.00067   26.3   1.2   33  177-209    16-48  (62)
418 TIGR00143 hypF [NiFe] hydrogen  28.9      23 0.00051   36.6   0.7   31  183-213   120-155 (711)
419 TIGR00869 sec62 protein transl  28.8      76  0.0017   29.2   3.9   16  172-188   182-197 (232)
420 PF12648 TcpE:  TcpE family      28.8      66  0.0014   25.1   3.1   21  165-185    64-84  (108)
421 PF11872 DUF3392:  Protein of u  28.7 1.3E+02  0.0029   24.7   4.9   16  163-178    91-106 (106)
422 PF14690 zf-ISL3:  zinc-finger   28.6      33 0.00072   22.5   1.2   15  199-213     3-17  (47)
423 PF06397 Desulfoferrod_N:  Desu  28.3      40 0.00087   22.9   1.5   18  196-213     4-21  (36)
424 PRK05654 acetyl-CoA carboxylas  28.2      21 0.00046   33.2   0.3   29  183-211    29-59  (292)
425 KOG1088 Uncharacterized conser  28.1      36 0.00079   28.9   1.6   17  198-214    98-114 (124)
426 PLN03120 nucleic acid binding   28.1      69  0.0015   29.9   3.5   30   67-96    165-194 (260)
427 TIGR00311 aIF-2beta translatio  27.9      34 0.00073   28.7   1.4   29  182-210    98-130 (133)
428 PF12674 Zn_ribbon_2:  Putative  27.8      37  0.0008   26.1   1.5   13  200-212     2-14  (81)
429 PF09567 RE_MamI:  MamI restric  27.7      26 0.00056   33.4   0.7   22  182-206    83-104 (314)
430 PF05077 DUF678:  Protein of un  27.6      35 0.00076   26.7   1.3   17  195-211    54-70  (74)
431 TIGR03518 ABC_perm_GldF glidin  27.6   2E+02  0.0044   25.1   6.2   28  118-145     1-28  (240)
432 PHA02893 hypothetical protein;  27.6      25 0.00053   28.4   0.5   15  196-210    67-81  (88)
433 PRK13415 flagella biosynthesis  27.5      85  0.0018   28.8   3.9   28  152-180    68-95  (219)
434 PF07295 DUF1451:  Protein of u  27.4      34 0.00073   29.1   1.3   26  182-207   113-139 (146)
435 PRK03988 translation initiatio  27.1      36 0.00077   28.7   1.4   29  182-210   103-135 (138)
436 TIGR02205 septum_zipA cell div  27.0      27 0.00059   32.6   0.7   26  153-178     2-27  (284)
437 PF03733 DUF307:  Domain of unk  27.0 1.9E+02  0.0042   20.6   4.9   24  134-157     2-25  (53)
438 KOG3059 N-acetylglucosaminyltr  26.8 2.6E+02  0.0057   26.8   7.1   14  117-130   209-222 (292)
439 TIGR02159 PA_CoA_Oxy4 phenylac  26.6      26 0.00056   29.6   0.5   27  182-208   106-140 (146)
440 KOG3012 Uncharacterized conser  26.6 2.1E+02  0.0047   26.9   6.4   35  121-156    68-105 (259)
441 PRK12652 putative monovalent c  26.5   1E+02  0.0023   29.4   4.5   21  173-193   232-252 (357)
442 PLN00050 expansin A; Provision  26.4      37 0.00079   31.3   1.4   10  229-238   137-146 (247)
443 TIGR01054 rgy reverse gyrase.   26.2      28 0.00062   38.0   0.8   23  182-207   679-701 (1171)
444 TIGR02230 ATPase_gene1 F0F1-AT  26.0      98  0.0021   25.1   3.6   23  134-156    48-70  (100)
445 PF07666 MpPF26:  M penetrans p  26.0 1.5E+02  0.0033   25.0   4.9   54  124-189    45-98  (130)
446 PF11172 DUF2959:  Protein of u  25.9 5.1E+02   0.011   23.6   8.6   25   66-90     61-85  (201)
447 PRK05580 primosome assembly pr  25.8      39 0.00084   34.4   1.6   29  183-211   392-421 (679)
448 PRK12651 putative monovalent c  25.6 1.4E+02  0.0031   24.9   4.7   12  139-150     9-20  (158)
449 TIGR00389 glyS_dimeric glycyl-  25.6      27 0.00059   35.4   0.5   48  160-207    63-133 (551)
450 PF14017 DUF4233:  Protein of u  25.6 2.1E+02  0.0047   23.1   5.5   43  139-181    40-102 (107)
451 KOG1792 Reticulon [Intracellul  25.5 1.6E+02  0.0034   26.9   5.2   41  136-176    57-97  (230)
452 PF10864 DUF2663:  Protein of u  25.5 1.7E+02  0.0038   24.8   5.2   63  116-178    10-80  (130)
453 PF04135 Nop10p:  Nucleolar RNA  25.4      56  0.0012   23.9   2.0   28  183-215     7-35  (53)
454 COG0551 TopA Zn-finger domain   25.3      66  0.0014   26.0   2.6   23  193-215    55-78  (140)
455 COG1645 Uncharacterized Zn-fin  25.2      26 0.00057   29.8   0.3   25  192-216    22-46  (131)
456 PF01780 Ribosomal_L37ae:  Ribo  25.1      40 0.00087   27.0   1.2   33  181-215    35-68  (90)
457 COG5345 Uncharacterized protei  25.0 1.2E+02  0.0027   29.5   4.7   26  150-176    29-54  (358)
458 PRK12860 transcriptional activ  24.9      67  0.0014   28.7   2.7   38  168-205   121-161 (189)
459 PF01873 eIF-5_eIF-2B:  Domain   24.8      57  0.0012   26.9   2.2   26  182-207    94-123 (125)
460 PRK14288 chaperone protein Dna  24.7      36 0.00078   32.1   1.1   12  193-204   173-184 (369)
461 PRK14297 chaperone protein Dna  24.6      41 0.00088   31.7   1.4   13  193-205   186-198 (380)
462 PF06724 DUF1206:  Domain of Un  24.6 1.5E+02  0.0033   21.4   4.2   32  120-151    31-63  (73)
463 PF04981 NMD3:  NMD3 family ;    24.6      34 0.00073   30.2   0.8   36  178-215    10-50  (236)
464 PF03811 Zn_Tnp_IS1:  InsA N-te  24.4      63  0.0014   21.6   1.9   18  197-214     4-22  (36)
465 PRK11595 DNA utilization prote  24.4      25 0.00055   30.6   0.0    9  200-208    36-44  (227)
466 PF11587 Prion_bPrPp:  Major pr  24.4      61  0.0013   21.4   1.8   13  132-144     4-16  (29)
467 PRK07333 2-octaprenyl-6-methox  24.4 4.3E+02  0.0093   23.7   7.8   73   54-128   298-385 (403)
468 COG0333 RpmF Ribosomal protein  24.4      37 0.00081   25.1   0.9   11  198-208    27-37  (57)
469 PF01194 RNA_pol_N:  RNA polyme  24.4      30 0.00065   25.9   0.4   14  198-211     4-17  (60)
470 PRK10633 hypothetical protein;  24.3 2.9E+02  0.0063   21.7   5.8   28  150-177    44-71  (80)
471 PF09527 ATPase_gene1:  Putativ  24.3 1.2E+02  0.0025   21.0   3.3   23  157-179     6-28  (55)
472 PF05502 Dynactin_p62:  Dynacti  24.1      47   0.001   32.9   1.8   36  179-214    24-68  (483)
473 TIGR02896 spore_III_AF stage I  24.1 1.9E+02  0.0042   23.4   5.0   37  134-170     3-54  (106)
474 PRK12475 thiamine/molybdopteri  23.8      59  0.0013   30.4   2.3   34  181-214   237-275 (338)
475 TIGR02163 napH_ ferredoxin-typ  23.8 5.3E+02   0.011   23.0   8.6   13  173-185   167-179 (255)
476 COG0068 HypF Hydrogenase matur  23.7      35 0.00075   36.2   0.8   30  183-212   153-187 (750)
477 PF13829 DUF4191:  Domain of un  23.7 3.1E+02  0.0067   25.2   6.7   22  163-184    63-87  (224)
478 COG5005 Mu-like prophage prote  23.7 1.2E+02  0.0026   26.3   3.9   36   66-101    15-50  (140)
479 cd03509 DesA_FADS-like Fatty a  23.6 3.9E+02  0.0084   24.5   7.5   14  122-135   113-126 (288)
480 PF01214 CK_II_beta:  Casein ki  23.6      50  0.0011   28.9   1.7   34  180-213    98-142 (184)
481 PRK14291 chaperone protein Dna  23.5      38 0.00083   32.0   1.0   13  193-205   190-202 (382)
482 PF04956 TrbC:  TrbC/VIRB2 fami  23.5 1.2E+02  0.0027   22.6   3.6   46  117-162    36-89  (99)
483 COG1885 Uncharacterized protei  23.4      38 0.00083   28.4   0.9   12  182-193    50-61  (115)
484 PF01907 Ribosomal_L37e:  Ribos  23.4      36 0.00077   25.3   0.6   26  181-208    15-40  (55)
485 cd04511 Nudix_Hydrolase_4 Memb  23.3      84  0.0018   24.2   2.7   29  184-214     1-33  (130)
486 PRK14278 chaperone protein Dna  23.3      42 0.00091   31.8   1.2   14  192-205   176-189 (378)
487 PRK07220 DNA topoisomerase I;   23.2      55  0.0012   33.9   2.1   37  178-214   632-673 (740)
488 KOG1842 FYVE finger-containing  23.2      19 0.00042   36.4  -1.0   37  173-211   173-209 (505)
489 cd01428 ADK Adenylate kinase (  23.2      67  0.0014   25.7   2.2   37  173-214   117-153 (194)
490 PHA02446 hypothetical protein   23.1      38 0.00083   29.3   0.8   15  198-212    62-76  (166)
491 TIGR00630 uvra excinuclease AB  23.1      48   0.001   35.5   1.7   27  178-206   733-767 (924)
492 PRK14526 adenylate kinase; Pro  23.0      89  0.0019   27.2   3.1   42  173-214   114-158 (211)
493 PTZ00073 60S ribosomal protein  22.9      39 0.00085   27.3   0.8   28  179-208    14-41  (91)
494 PHA02929 N1R/p28-like protein;  22.7      50  0.0011   30.2   1.6   22  173-197   211-232 (238)
495 PRK01343 zinc-binding protein;  22.7      43 0.00093   24.9   0.9   14  179-192     7-20  (57)
496 PRK12268 methionyl-tRNA synthe  22.6      36 0.00078   33.1   0.7   27  178-208   138-164 (556)
497 PF08804 gp32:  gp32 DNA bindin  22.5      11 0.00023   30.6  -2.4   15  182-196    59-75  (94)
498 TIGR00244 transcriptional regu  22.5      38 0.00082   29.3   0.7   17  183-199    30-46  (147)
499 PF12171 zf-C2H2_jaz:  Zinc-fin  22.4      46   0.001   19.9   0.9   13  183-195     3-15  (27)
500 PF00452 Bcl-2:  Apoptosis regu  22.3 3.1E+02  0.0067   20.4   5.6   58   92-149     2-65  (101)

No 1  
>PRK00420 hypothetical protein; Validated
Probab=98.57  E-value=2.8e-08  Score=80.62  Aligned_cols=35  Identities=17%  Similarity=0.428  Sum_probs=32.9

Q ss_pred             hcCCCCCCCccccccccceeecCCCCceeeeeCCC
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      -.+.||+||++++++++.+.+||+||+++.+++++
T Consensus        22 l~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~v~~~e   56 (112)
T PRK00420         22 LSKHCPVCGLPLFELKDGEVVCPVHGKVYIVKSDE   56 (112)
T ss_pred             ccCCCCCCCCcceecCCCceECCCCCCeeeeccHH
Confidence            45999999999999999999999999999999875


No 2  
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=97.02  E-value=0.0005  Score=55.40  Aligned_cols=31  Identities=29%  Similarity=0.651  Sum_probs=28.7

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeeee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      +-.||.||..|-=||...+.||.||+.....
T Consensus         9 KR~Cp~CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    9 KRTCPSCGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cccCCCCcchhccCCCCCccCCCCCCccCcc
Confidence            4579999999999999999999999998887


No 3  
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=96.95  E-value=0.0024  Score=52.70  Aligned_cols=37  Identities=14%  Similarity=0.272  Sum_probs=29.4

Q ss_pred             hhhhhcCCCCCCCccccccccceeecCCCCceeeeeCC
Q 026283          176 NNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       176 kRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      --..+.-.||.|+.+.-=+..++ +|+.|+++|+....
T Consensus        64 Stkav~V~CP~C~K~TKmLGr~D-~CM~C~~pLTLd~~  100 (114)
T PF11023_consen   64 STKAVQVECPNCGKQTKMLGRVD-ACMHCKEPLTLDPS  100 (114)
T ss_pred             cccceeeECCCCCChHhhhchhh-ccCcCCCcCccCch
Confidence            44557778999999986555554 99999999998764


No 4  
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=96.74  E-value=0.0011  Score=45.06  Aligned_cols=34  Identities=26%  Similarity=0.441  Sum_probs=27.5

Q ss_pred             hcCCCCCCCccccccccc-eeecCCCCceeeeeCC
Q 026283          180 IKGACPACKREFIGSKSQ-IIRCAGCGNIVWQPEG  213 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt-~~~CpnCGe~l~v~~g  213 (240)
                      ++-.||.||.+|.--... ...||+||..+.....
T Consensus         2 ~~y~C~~CG~~~~~~~~~~~~~Cp~CG~~~~~~~~   36 (46)
T PRK00398          2 AEYKCARCGREVELDEYGTGVRCPYCGYRILFKER   36 (46)
T ss_pred             CEEECCCCCCEEEECCCCCceECCCCCCeEEEccC
Confidence            456799999999766555 8999999999887654


No 5  
>PRK02935 hypothetical protein; Provisional
Probab=96.61  E-value=0.0086  Score=49.27  Aligned_cols=39  Identities=13%  Similarity=0.345  Sum_probs=31.0

Q ss_pred             HhhhhhcCCCCCCCccccccccceeecCCCCceeeeeCCC
Q 026283          175 ANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       175 lkRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      +.-..+.-.||.|+.+ |=.-+.+-.|+.|+|||+...++
T Consensus        64 lStkavqV~CP~C~K~-TKmLGrvD~CM~C~~PLTLd~~l  102 (110)
T PRK02935         64 LSTKAVQVICPSCEKP-TKMLGRVDACMHCNQPLTLDRSL  102 (110)
T ss_pred             hcccceeeECCCCCch-hhhccceeecCcCCCcCCcCccc
Confidence            4456777899999987 44556677999999999987765


No 6  
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=96.37  E-value=0.0017  Score=54.55  Aligned_cols=31  Identities=16%  Similarity=0.179  Sum_probs=27.1

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeeee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      +-.||.||..|--||...+.||.||+.....
T Consensus         9 Kr~Cp~cg~kFYDLnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         9 KRICPNTGSKFYDLNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cccCCCcCccccccCCCCccCCCcCCccCcc
Confidence            4479999999999999999999999985433


No 7  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=96.17  E-value=0.0023  Score=39.52  Aligned_cols=25  Identities=28%  Similarity=0.683  Sum_probs=20.9

Q ss_pred             cCCCCCCCccccccccceeecCCCCcee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      +..||.|+.+   +......||+||..|
T Consensus         2 ~~~Cp~Cg~~---~~~~~~fC~~CG~~L   26 (26)
T PF13248_consen    2 EMFCPNCGAE---IDPDAKFCPNCGAKL   26 (26)
T ss_pred             cCCCcccCCc---CCcccccChhhCCCC
Confidence            4679999994   577888999999875


No 8  
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=95.95  E-value=0.0032  Score=51.74  Aligned_cols=34  Identities=18%  Similarity=0.549  Sum_probs=25.5

Q ss_pred             cCCCCCCCccccccccc-------eeecCCCCceeeeeCCC
Q 026283          181 KGACPACKREFIGSKSQ-------IIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt-------~~~CpnCGe~l~v~~g~  214 (240)
                      .-.||.|+..|+-..-.       ...||+||++|...+..
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l~~~dn~  139 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQLLDMDGTFTCPRCGEELEEDDNS  139 (147)
T ss_pred             EEECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEEEEcCch
Confidence            34599999999853221       28999999999886653


No 9  
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=95.88  E-value=0.0038  Score=40.32  Aligned_cols=28  Identities=25%  Similarity=0.593  Sum_probs=22.4

Q ss_pred             cCCCCCCCccccccc----cceeecCCCCcee
Q 026283          181 KGACPACKREFIGSK----SQIIRCAGCGNIV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG~n----nt~~~CpnCGe~l  208 (240)
                      +-.||.|+.+|.-..    .....||+||..+
T Consensus         5 ~y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~~   36 (41)
T smart00834        5 EYRCEDCGHTFEVLQKISDDPLATCPECGGDV   36 (41)
T ss_pred             EEEcCCCCCEEEEEEecCCCCCCCCCCCCCcc
Confidence            457999999887554    5678999999854


No 10 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=95.86  E-value=0.007  Score=39.21  Aligned_cols=29  Identities=31%  Similarity=0.800  Sum_probs=21.4

Q ss_pred             CCCCCCCcccccc------ccceeecCCCCceeee
Q 026283          182 GACPACKREFIGS------KSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       182 g~CPvC~~eFtG~------nnt~~~CpnCGe~l~v  210 (240)
                      -.||.|+..|.==      +....+||+||+.+.+
T Consensus         3 ~~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~~~   37 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLGANGGKVRCGKCGHVWYA   37 (38)
T ss_pred             EECCCCCCEEEeCHHHcCCCCCEEECCCCCCEEEe
Confidence            3699999876432      3446899999998865


No 11 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=95.54  E-value=0.0085  Score=50.36  Aligned_cols=33  Identities=27%  Similarity=0.596  Sum_probs=26.4

Q ss_pred             hhcCCCCCCCccccccccceeecCCCC-ceeeeeC
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCG-NIVWQPE  212 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCG-e~l~v~~  212 (240)
                      .-..+||.||.+++= ++..+.||+|| ..+.|+.
T Consensus        26 ML~~hCp~Cg~PLF~-KdG~v~CPvC~~~~~~v~~   59 (131)
T COG1645          26 MLAKHCPKCGTPLFR-KDGEVFCPVCGYREVVVEE   59 (131)
T ss_pred             HHHhhCcccCCccee-eCCeEECCCCCceEEEeec
Confidence            345789999999999 88888999999 5555543


No 12 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=95.53  E-value=0.0078  Score=40.42  Aligned_cols=31  Identities=23%  Similarity=0.549  Sum_probs=22.4

Q ss_pred             CCCCCCCcccc--ccccceeecCCCCceeeeeC
Q 026283          182 GACPACKREFI--GSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       182 g~CPvC~~eFt--G~nnt~~~CpnCGe~l~v~~  212 (240)
                      +.||.|+...+  =..+....|++||.+|....
T Consensus         1 m~Cp~Cg~~~~~~D~~~g~~vC~~CG~Vl~e~~   33 (43)
T PF08271_consen    1 MKCPNCGSKEIVFDPERGELVCPNCGLVLEENI   33 (43)
T ss_dssp             ESBTTTSSSEEEEETTTTEEEETTT-BBEE-TT
T ss_pred             CCCcCCcCCceEEcCCCCeEECCCCCCEeeccc
Confidence            37999999764  34577889999999886543


No 13 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=95.47  E-value=0.006  Score=37.20  Aligned_cols=23  Identities=30%  Similarity=0.833  Sum_probs=18.6

Q ss_pred             CCCCCCccccccccceeecCCCCcee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      .||.||.+.   ......||+||.+|
T Consensus         1 ~Cp~CG~~~---~~~~~fC~~CG~~l   23 (23)
T PF13240_consen    1 YCPNCGAEI---EDDAKFCPNCGTPL   23 (23)
T ss_pred             CCcccCCCC---CCcCcchhhhCCcC
Confidence            499999986   45677799999875


No 14 
>PRK05978 hypothetical protein; Provisional
Probab=95.46  E-value=0.0081  Score=51.06  Aligned_cols=36  Identities=31%  Similarity=0.636  Sum_probs=32.2

Q ss_pred             hcCCCCCCCcc--ccccccceeecCCCCceeeeeCCCc
Q 026283          180 IKGACPACKRE--FIGSKSQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       180 Ieg~CPvC~~e--FtG~nnt~~~CpnCGe~l~v~~g~F  215 (240)
                      ..+.||.|+..  |.||-...-.|++||+.+..+++++
T Consensus        32 l~grCP~CG~G~LF~g~Lkv~~~C~~CG~~~~~~~a~D   69 (148)
T PRK05978         32 FRGRCPACGEGKLFRAFLKPVDHCAACGEDFTHHRADD   69 (148)
T ss_pred             HcCcCCCCCCCcccccccccCCCccccCCccccCCccc
Confidence            46899999865  8899999999999999999998765


No 15 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=95.37  E-value=0.012  Score=36.91  Aligned_cols=23  Identities=26%  Similarity=0.742  Sum_probs=20.6

Q ss_pred             CCCCCccccccc-cceeecCCCCc
Q 026283          184 CPACKREFIGSK-SQIIRCAGCGN  206 (240)
Q Consensus       184 CPvC~~eFtG~n-nt~~~CpnCGe  206 (240)
                      |-.|+.+..+-+ .....|||||+
T Consensus         1 C~sC~~~i~~r~~~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGRPIAPREQAVPFPCPNCGF   24 (24)
T ss_pred             CccCCCcccCcccCceEeCCCCCC
Confidence            678999999988 88899999996


No 16 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=95.31  E-value=0.0083  Score=51.86  Aligned_cols=24  Identities=29%  Similarity=0.595  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      --||||||-.-|  ...-+||.||-+
T Consensus       135 ~vC~vCGy~~~g--e~P~~CPiCga~  158 (166)
T COG1592         135 WVCPVCGYTHEG--EAPEVCPICGAP  158 (166)
T ss_pred             EEcCCCCCcccC--CCCCcCCCCCCh
Confidence            359999999999  788899999964


No 17 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=95.11  E-value=0.013  Score=48.25  Aligned_cols=33  Identities=21%  Similarity=0.521  Sum_probs=25.4

Q ss_pred             CCCCCCCccccccc--------------------cceeecCCCCce-eeeeCCC
Q 026283          182 GACPACKREFIGSK--------------------SQIIRCAGCGNI-VWQPEGD  214 (240)
Q Consensus       182 g~CPvC~~eFtG~n--------------------nt~~~CpnCGe~-l~v~~g~  214 (240)
                      ..|+.||+.|.--.                    ....+||.||.. +.+..|+
T Consensus        71 ~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~~~~i~~G~  124 (135)
T PRK03824         71 LKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSRDFEIVKGR  124 (135)
T ss_pred             EECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCCCcEEecCc
Confidence            36999999987652                    455779999975 7887775


No 18 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=95.08  E-value=0.011  Score=47.36  Aligned_cols=33  Identities=18%  Similarity=0.373  Sum_probs=26.3

Q ss_pred             CCCCCCCccccccccceeecCCCCce-eeeeCCC
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI-VWQPEGD  214 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~-l~v~~g~  214 (240)
                      ..|+.|++.|.--.+....||.||.. +.+..|+
T Consensus        71 ~~C~~Cg~~~~~~~~~~~~CP~Cgs~~~~i~~G~  104 (114)
T PRK03681         71 CWCETCQQYVTLLTQRVRRCPQCHGDMLRIVADD  104 (114)
T ss_pred             EEcccCCCeeecCCccCCcCcCcCCCCcEEccCC
Confidence            46999999888777766889999964 6777664


No 19 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=94.65  E-value=0.026  Score=37.31  Aligned_cols=27  Identities=30%  Similarity=0.987  Sum_probs=19.1

Q ss_pred             CCCCCCccc------cccccceeecCCCCceee
Q 026283          183 ACPACKREF------IGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       183 ~CPvC~~eF------tG~nnt~~~CpnCGe~l~  209 (240)
                      +||.|+..|      .+-.+...+||+||++-.
T Consensus         4 ~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             ECCCCCceEEcCHHHcccCCcEEECCCCCcEee
Confidence            588888776      345566788888887643


No 20 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=94.51  E-value=0.011  Score=46.97  Aligned_cols=32  Identities=28%  Similarity=0.588  Sum_probs=23.4

Q ss_pred             CCCCCCCccccccccceeecCCCCce-eeeeCCC
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI-VWQPEGD  214 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~-l~v~~g~  214 (240)
                      ..|+.|+++|.--... ..||+||.. +.+.+|+
T Consensus        71 ~~C~~Cg~~~~~~~~~-~~CP~Cgs~~~~i~~G~  103 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFD-FSCPRCGSPDVEIISGR  103 (113)
T ss_dssp             EEETTTS-EEECHHCC-HH-SSSSSS-EEEEESS
T ss_pred             EECCCCCCEEecCCCC-CCCcCCcCCCcEEccCC
Confidence            4699999999765555 789999997 5777764


No 21 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=94.46  E-value=0.018  Score=50.35  Aligned_cols=31  Identities=29%  Similarity=0.711  Sum_probs=22.7

Q ss_pred             cCCCCCCCcccccc--------------------------ccceeecCCCCceeeee
Q 026283          181 KGACPACKREFIGS--------------------------KSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       181 eg~CPvC~~eFtG~--------------------------nnt~~~CpnCGe~l~v~  211 (240)
                      +-.||||+.+|+--                          --.+..||+||-.-...
T Consensus         5 ~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    5 KITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             ceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            45799999999632                          12467899999876544


No 22 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=94.44  E-value=0.037  Score=40.08  Aligned_cols=32  Identities=22%  Similarity=0.509  Sum_probs=25.5

Q ss_pred             cCCCCCCCcccc---ccccceeecCCCCceeeeeC
Q 026283          181 KGACPACKREFI---GSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       181 eg~CPvC~~eFt---G~nnt~~~CpnCGe~l~v~~  212 (240)
                      ...||+|+.++.   ...+....||.||-.|.|-.
T Consensus         2 ~~~CP~CG~~iev~~~~~GeiV~Cp~CGaeleVv~   36 (54)
T TIGR01206         2 QFECPDCGAEIELENPELGELVICDECGAELEVVS   36 (54)
T ss_pred             ccCCCCCCCEEecCCCccCCEEeCCCCCCEEEEEe
Confidence            358999999874   23468899999999998854


No 23 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=94.25  E-value=0.041  Score=40.01  Aligned_cols=32  Identities=28%  Similarity=0.576  Sum_probs=27.7

Q ss_pred             CCCCCCCccc-----------------------------cccccceeecCCCCceeeeeCC
Q 026283          182 GACPACKREF-----------------------------IGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~eF-----------------------------tG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      -.||+|+.++                             +-.-.....||+||..--|.+|
T Consensus         8 L~Cp~ck~pL~~~~l~~~~~~~~~~lp~~~~~~~~~l~~~~i~eg~L~Cp~c~r~YPI~dG   68 (68)
T PF03966_consen    8 LACPVCKGPLDWEALVETAQLGLSELPKELPEDYHVLLEVEIVEGELICPECGREYPIRDG   68 (68)
T ss_dssp             BB-TTTSSBEHHHHHHHHHHCCCCHCHHCHHCHCEHHCTEETTTTEEEETTTTEEEEEETT
T ss_pred             hcCCCCCCcchHHHHHHHHHhCcccCCCCCccchhhhhcccccCCEEEcCCCCCEEeCCCC
Confidence            4799999999                             6888899999999999988887


No 24 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=94.17  E-value=0.047  Score=37.84  Aligned_cols=32  Identities=25%  Similarity=0.525  Sum_probs=27.8

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeeeCC
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      -.|..||.+|.=-....++||+||--+-....
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~rIlyK~R   34 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGYRILYKKR   34 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCceEEEEeC
Confidence            46999999999888999999999998887654


No 25 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=94.15  E-value=0.034  Score=36.79  Aligned_cols=25  Identities=36%  Similarity=1.140  Sum_probs=19.2

Q ss_pred             CCCCCCccc------cccccceeecCCCCce
Q 026283          183 ACPACKREF------IGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eF------tG~nnt~~~CpnCGe~  207 (240)
                      .||.|+..|      +.-+....+|++||+.
T Consensus         4 ~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~   34 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKIPPKGRKVRCSKCGHV   34 (36)
T ss_pred             ECCCCCCEEeCCHHHCCCCCcEEECCCCCCE
Confidence            588888877      4566678888888875


No 26 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=93.77  E-value=0.042  Score=37.82  Aligned_cols=28  Identities=29%  Similarity=0.791  Sum_probs=25.0

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCC
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCG  205 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCG  205 (240)
                      .+....||.|+.+..-.++.+..||+|+
T Consensus        14 ~ML~~~Cp~C~~PL~~~k~g~~~Cv~C~   41 (41)
T PF06677_consen   14 TMLDEHCPDCGTPLMRDKDGKIYCVSCG   41 (41)
T ss_pred             hHhcCccCCCCCeeEEecCCCEECCCCC
Confidence            4567899999999999888899999996


No 27 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=93.72  E-value=0.049  Score=38.89  Aligned_cols=27  Identities=22%  Similarity=0.661  Sum_probs=24.0

Q ss_pred             cCCCCCCCccccc-cccceeecCCCCce
Q 026283          181 KGACPACKREFIG-SKSQIIRCAGCGNI  207 (240)
Q Consensus       181 eg~CPvC~~eFtG-~nnt~~~CpnCGe~  207 (240)
                      .-.||.||+.-.. .++....||+||..
T Consensus        28 Sq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   28 SQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             ccCccCcccccccccccceEEcCCCCCE
Confidence            4579999999888 89999999999976


No 28 
>PF14353 CpXC:  CpXC protein
Probab=93.69  E-value=0.041  Score=43.60  Aligned_cols=32  Identities=25%  Similarity=0.547  Sum_probs=23.2

Q ss_pred             cCCCCCCCccccc-----ccc--c-------------eeecCCCCceeeeeC
Q 026283          181 KGACPACKREFIG-----SKS--Q-------------IIRCAGCGNIVWQPE  212 (240)
Q Consensus       181 eg~CPvC~~eFtG-----~nn--t-------------~~~CpnCGe~l~v~~  212 (240)
                      |-+||.|+.+|.-     +|-  +             ..+||+||....++-
T Consensus         1 ~itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~~   52 (128)
T PF14353_consen    1 EITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLEY   52 (128)
T ss_pred             CcCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecCC
Confidence            3589999999853     221  1             568999999887754


No 29 
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type. The N-terminal region of about 200 amino acids is rich in low-complexity sequence, poorly alignable, and not included n this model.
Probab=93.66  E-value=0.047  Score=58.81  Aligned_cols=54  Identities=28%  Similarity=0.418  Sum_probs=35.4

Q ss_pred             CCCCCCc-cc-------cccccceeecCCCCceeeeeCCCcccCCCCCCCCCCCCCCeeeeecc
Q 026283          183 ACPACKR-EF-------IGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDVDFE  238 (240)
Q Consensus       183 ~CPvC~~-eF-------tG~nnt~~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtIDVe~e  238 (240)
                      -||.|+| ||       .||.=..-.||+||+++.-..-+- .=+-+=+..|.+.|| ||++|.
T Consensus       685 ~c~~c~~~ef~~~~~~~sg~dlp~k~cp~c~~~~~~dg~~L-~FErFLn~er~~~PD-IDldF~  746 (1213)
T TIGR01405       685 LCPNCKYSEFITDGSVGSGFDLPDKDCPKCGAPLKKDGQDI-PFETFLGFKGDKVPD-IDLNFS  746 (1213)
T ss_pred             cCcccccccccccccccccccCccccCccccccccccCCCc-eeeeccCCCCCCCCC-CcccCc
Confidence            5999998 33       477777889999999876443110 001112456778887 688875


No 30 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=93.63  E-value=0.042  Score=46.66  Aligned_cols=22  Identities=27%  Similarity=0.990  Sum_probs=19.7

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      -.||.||+    +......||+||..
T Consensus       310 ~~C~~cg~----~~~r~~~C~~cg~~  331 (364)
T COG0675         310 KTCPCCGH----LSGRLFKCPRCGFV  331 (364)
T ss_pred             ccccccCC----ccceeEECCCCCCe
Confidence            56999999    77889999999985


No 31 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=93.55  E-value=0.04  Score=44.33  Aligned_cols=34  Identities=21%  Similarity=0.420  Sum_probs=25.6

Q ss_pred             cCCCCCCCccccccccceeecCCCCce-eeeeCCC
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNI-VWQPEGD  214 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~-l~v~~g~  214 (240)
                      ...|+.|++.|.=-.+...+||.||.. +.+.+|+
T Consensus        71 ~~~C~~Cg~~~~~~~~~~~~CP~Cgs~~~~i~~G~  105 (117)
T PRK00564         71 ELECKDCSHVFKPNALDYGVCEKCHSKNVIITQGN  105 (117)
T ss_pred             EEEhhhCCCccccCCccCCcCcCCCCCceEEecCC
Confidence            346999998887665566679999974 6767764


No 32 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=93.49  E-value=0.039  Score=44.15  Aligned_cols=33  Identities=18%  Similarity=0.363  Sum_probs=23.7

Q ss_pred             cCCCCCCCccccccccceeecCCCCc-eeeeeCCC
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGN-IVWQPEGD  214 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe-~l~v~~g~  214 (240)
                      ...|+.|+++|.--. ....||+||. .+.+.+|+
T Consensus        70 ~~~C~~Cg~~~~~~~-~~~~CP~Cgs~~~~i~~G~  103 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ-HDAQCPHCHGERLRVDTGD  103 (113)
T ss_pred             EEEcccCCCEEecCC-cCccCcCCCCCCcEEccCC
Confidence            356999998876543 3445999996 46777774


No 33 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=93.43  E-value=0.042  Score=46.15  Aligned_cols=32  Identities=19%  Similarity=0.331  Sum_probs=23.4

Q ss_pred             CCCCCCCcccccc--ccceeecCCCCceeeeeCC
Q 026283          182 GACPACKREFIGS--KSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~eFtG~--nnt~~~CpnCGe~l~v~~g  213 (240)
                      =.||.|+.+|+=.  -+-...||+||++|..-+.
T Consensus       110 Y~Cp~c~~r~tf~eA~~~~F~Cp~Cg~~L~~~dn  143 (158)
T TIGR00373       110 FICPNMCVRFTFNEAMELNFTCPRCGAMLDYLDN  143 (158)
T ss_pred             EECCCCCcEeeHHHHHHcCCcCCCCCCEeeeccC
Confidence            3599999887632  2246899999999976543


No 34 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.36  E-value=0.046  Score=35.25  Aligned_cols=23  Identities=30%  Similarity=0.785  Sum_probs=19.8

Q ss_pred             CCCCCCccccccccceeecCCCCc
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      .|++|||.+.+-. ..-.||.||.
T Consensus         3 ~C~~CGy~y~~~~-~~~~CP~Cg~   25 (33)
T cd00350           3 VCPVCGYIYDGEE-APWVCPVCGA   25 (33)
T ss_pred             ECCCCCCEECCCc-CCCcCcCCCC
Confidence            5999999999865 5668999997


No 35 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=93.35  E-value=0.052  Score=44.55  Aligned_cols=26  Identities=38%  Similarity=1.097  Sum_probs=21.9

Q ss_pred             CCCCCccccccccceeecCCCCceeeeeCCCc
Q 026283          184 CPACKREFIGSKSQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       184 CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~F  215 (240)
                      ||||+.++   .-|+..|++||..+   .|+|
T Consensus         1 CPvCg~~l---~vt~l~C~~C~t~i---~G~F   26 (113)
T PF09862_consen    1 CPVCGGEL---VVTRLKCPSCGTEI---EGEF   26 (113)
T ss_pred             CCCCCCce---EEEEEEcCCCCCEE---Eeee
Confidence            99999875   47899999999876   4777


No 36 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=93.31  E-value=0.07  Score=39.76  Aligned_cols=28  Identities=21%  Similarity=0.655  Sum_probs=24.4

Q ss_pred             cCCCCCCCccccccc-cceeecCCCCcee
Q 026283          181 KGACPACKREFIGSK-SQIIRCAGCGNIV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG~n-nt~~~CpnCGe~l  208 (240)
                      ...|-.|+.+..+.. .+..-||||||.+
T Consensus         7 ~~~CtSCg~~i~~~~~~~~F~CPnCG~~~   35 (59)
T PRK14890          7 PPKCTSCGIEIAPREKAVKFLCPNCGEVI   35 (59)
T ss_pred             CccccCCCCcccCCCccCEeeCCCCCCee
Confidence            346999999999887 8999999999983


No 37 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=92.90  E-value=0.078  Score=40.47  Aligned_cols=35  Identities=29%  Similarity=0.714  Sum_probs=29.0

Q ss_pred             hcCCCCCCCcccccc--ccceeecCCCCceeeeeCCC
Q 026283          180 IKGACPACKREFIGS--KSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~--nnt~~~CpnCGe~l~v~~g~  214 (240)
                      ..-.||-|+++=+=|  -++..+|++||..|-.|-|.
T Consensus        18 l~VkCpdC~N~q~vFshast~V~C~~CG~~l~~PTGG   54 (67)
T COG2051          18 LRVKCPDCGNEQVVFSHASTVVTCLICGTTLAEPTGG   54 (67)
T ss_pred             EEEECCCCCCEEEEeccCceEEEecccccEEEecCCC
Confidence            345799999997755  46788999999999998874


No 38 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=92.81  E-value=0.055  Score=35.25  Aligned_cols=26  Identities=27%  Similarity=0.823  Sum_probs=16.1

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .+||.|+.+++=..+.+..||.||.+
T Consensus         3 p~Cp~C~se~~y~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    3 PKCPLCGSEYTYEDGELLVCPECGHE   28 (30)
T ss_dssp             ---TTT-----EE-SSSEEETTTTEE
T ss_pred             CCCCCCCCcceeccCCEEeCCccccc
Confidence            58999999999999999999999975


No 39 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=92.81  E-value=0.058  Score=33.91  Aligned_cols=23  Identities=30%  Similarity=0.729  Sum_probs=17.6

Q ss_pred             CCCCCCccccccccceeecCCCCcee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      .||.|+.+-   ..+...||+||-..
T Consensus         2 ~CP~C~~~V---~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEV---PESAKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCc---hhhcCcCCCCCCCC
Confidence            588888875   66777889998653


No 40 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=92.81  E-value=0.067  Score=40.18  Aligned_cols=28  Identities=29%  Similarity=0.754  Sum_probs=24.5

Q ss_pred             CCCCCCccc-cccccceeecCCCCceeee
Q 026283          183 ACPACKREF-IGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       183 ~CPvC~~eF-tG~nnt~~~CpnCGe~l~v  210 (240)
                      .|-.|+.+. .|-+.+..-||||||.+-.
T Consensus        11 ~CtSCg~~i~p~e~~v~F~CPnCGe~~I~   39 (61)
T COG2888          11 VCTSCGREIAPGETAVKFPCPNCGEVEIY   39 (61)
T ss_pred             eeccCCCEeccCCceeEeeCCCCCceeee
Confidence            688999999 8999999999999977644


No 41 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=92.70  E-value=0.083  Score=37.58  Aligned_cols=28  Identities=25%  Similarity=0.676  Sum_probs=16.9

Q ss_pred             cCCCCCCCccccccccceeecCCCCceee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      ...|+.|+..| ++-+..-.|.+||+++=
T Consensus         9 ~~~C~~C~~~F-~~~~rrhhCr~CG~~vC   36 (69)
T PF01363_consen    9 ASNCMICGKKF-SLFRRRHHCRNCGRVVC   36 (69)
T ss_dssp             -SB-TTT--B--BSSS-EEE-TTT--EEE
T ss_pred             CCcCcCcCCcC-CCceeeEccCCCCCEEC
Confidence            46899999999 88899999999999874


No 42 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=92.63  E-value=0.049  Score=46.76  Aligned_cols=33  Identities=24%  Similarity=0.549  Sum_probs=24.5

Q ss_pred             hcCCCCCCCccccccc--cceeecCCCCceeeeeC
Q 026283          180 IKGACPACKREFIGSK--SQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~n--nt~~~CpnCGe~l~v~~  212 (240)
                      ..=.||.|+.+|+=..  +-...||+||++|..-+
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~~~F~Cp~Cg~~L~~~d  150 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAMEYGFRCPQCGEMLEEYD  150 (178)
T ss_pred             CEEECCCCCcEEeHHHHhhcCCcCCCCCCCCeecc
Confidence            3446999999887432  23689999999997654


No 43 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=92.49  E-value=0.077  Score=40.61  Aligned_cols=46  Identities=26%  Similarity=0.600  Sum_probs=23.4

Q ss_pred             cCCCCCCCccccccc------------cceeecCCCCceeeeeC--C--CcccCCCCC--CCCC
Q 026283          181 KGACPACKREFIGSK------------SQIIRCAGCGNIVWQPE--G--DFFSRNGGG--KKST  226 (240)
Q Consensus       181 eg~CPvC~~eFtG~n------------nt~~~CpnCGe~l~v~~--g--~F~s~~g~~--~~~r  226 (240)
                      |-.||.|+.+..=-+            ..+-.||.||++|.+=+  |  +||=..|.|  |++|
T Consensus         1 e~~CP~C~~~L~~~~~~~~C~~C~~~~~~~a~CPdC~~~Le~LkACGAvdYFC~~c~gLiSKkr   64 (70)
T PF07191_consen    1 ENTCPKCQQELEWQGGHYHCEACQKDYKKEAFCPDCGQPLEVLKACGAVDYFCNHCHGLISKKR   64 (70)
T ss_dssp             --B-SSS-SBEEEETTEEEETTT--EEEEEEE-TTT-SB-EEEEETTEEEEE-TTTT-EE-TTT
T ss_pred             CCcCCCCCCccEEeCCEEECccccccceecccCCCcccHHHHHHHhcccceeeccCCceeecce
Confidence            346888887754333            34567999999998765  3  566666666  5544


No 44 
>PRK12495 hypothetical protein; Provisional
Probab=92.04  E-value=0.084  Score=48.03  Aligned_cols=28  Identities=18%  Similarity=0.400  Sum_probs=24.9

Q ss_pred             CCCCCCCccccccccceeecCCCCceeee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      -.||+||.+..-+ ..+++||+|++++..
T Consensus        43 ~hC~~CG~PIpa~-pG~~~Cp~CQ~~~~~   70 (226)
T PRK12495         43 AHCDECGDPIFRH-DGQEFCPTCQQPVTE   70 (226)
T ss_pred             hhcccccCcccCC-CCeeECCCCCCcccc
Confidence            4799999999987 778889999999885


No 45 
>PRK00448 polC DNA polymerase III PolC; Validated
Probab=91.89  E-value=0.11  Score=56.92  Aligned_cols=55  Identities=24%  Similarity=0.338  Sum_probs=35.5

Q ss_pred             CCCCCCCcccc--------ccccceeecCCCCceeeeeCCCcccCCCCCCCCCCCCCCeeeeecc
Q 026283          182 GACPACKREFI--------GSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDVDFE  238 (240)
Q Consensus       182 g~CPvC~~eFt--------G~nnt~~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtIDVe~e  238 (240)
                      --||.|+|.=.        |+.=-.--||+||+++. .+||=-.=+-+=+..|.+.|| ||++|.
T Consensus       909 y~C~~C~~~ef~~~~~~~sG~Dlpdk~Cp~Cg~~~~-kdg~~l~FErFL~~~r~~~PD-IDldF~  971 (1437)
T PRK00448        909 YVCPNCKYSEFFTDGSVGSGFDLPDKDCPKCGTKLK-KDGHDIPFETFLGFKGDKVPD-IDLNFS  971 (1437)
T ss_pred             ccCcccccccccccccccccccCccccCcccccccc-ccCCCceeeeccCCCCCCCCC-CcccCc
Confidence            35999998543        67777778999999865 444300001112446777777 688875


No 46 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.72  E-value=0.1  Score=34.22  Aligned_cols=24  Identities=29%  Similarity=0.696  Sum_probs=19.5

Q ss_pred             CCCCCCccccccccceeecCCCCce
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .|++|||.+.|-. -.-.||.||.+
T Consensus         4 ~C~~CG~i~~g~~-~p~~CP~Cg~~   27 (34)
T cd00729           4 VCPVCGYIHEGEE-APEKCPICGAP   27 (34)
T ss_pred             ECCCCCCEeECCc-CCCcCcCCCCc
Confidence            6999999999854 44589999974


No 47 
>PLN03120 nucleic acid binding protein; Provisional
Probab=91.34  E-value=0.23  Score=45.80  Aligned_cols=55  Identities=16%  Similarity=0.309  Sum_probs=46.4

Q ss_pred             hHHHHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhhhhhhHhHHhhhhhhhh
Q 026283           63 LVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRMDFSR  117 (240)
Q Consensus        63 ~~fear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~fgi~rR~R~f~~D~~r  117 (240)
                      +.-.|......+|++|-+|.|++.-.-.++|++++||++|+|.-+..++..=..+
T Consensus       137 ~ss~a~a~v~~~d~k~gltek~~~g~~~v~~~~k~vDeky~vs~kt~sa~~~~~~  191 (260)
T PLN03120        137 LTSTASAKVASLDKKIGLSEKLSAGTAVVNEKVKEVDQKYQVSEKTKSALAAAEQ  191 (260)
T ss_pred             hHHHHHHHHHhhhhhcCcccccccchHHHHHHHHhhhhhhchhHHHHHHHHHHHH
Confidence            3445666778899999999999998889999999999999999999886655444


No 48 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=91.27  E-value=0.12  Score=41.53  Aligned_cols=34  Identities=24%  Similarity=0.586  Sum_probs=25.0

Q ss_pred             hcCCCCCCCccccccccceeecCCCCce-eeeeCCC
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNI-VWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~-l~v~~g~  214 (240)
                      +...|+.|+++|.--.. ...||+||.. +.+..|+
T Consensus        69 ~~~~C~~Cg~~~~~~~~-~~~CP~Cgs~~~~i~~G~  103 (115)
T TIGR00100        69 VECECEDCSEEVSPEID-LYRCPKCHGIMLQVRAGK  103 (115)
T ss_pred             cEEEcccCCCEEecCCc-CccCcCCcCCCcEEecCC
Confidence            35679999988765443 4679999974 6777775


No 49 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=91.15  E-value=0.12  Score=38.44  Aligned_cols=36  Identities=33%  Similarity=0.759  Sum_probs=29.8

Q ss_pred             hhcCCCCCCCcccccc--ccceeecCCCCceeeeeCCC
Q 026283          179 VIKGACPACKREFIGS--KSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~--nnt~~~CpnCGe~l~v~~g~  214 (240)
                      .+.-.||.|+++=+=|  -++...|+.||..|-.|-|.
T Consensus         9 F~~VkCp~C~n~q~vFsha~t~V~C~~Cg~~L~~PtGG   46 (59)
T PRK00415          9 FLKVKCPDCGNEQVVFSHASTVVRCLVCGKTLAEPTGG   46 (59)
T ss_pred             EEEEECCCCCCeEEEEecCCcEEECcccCCCcccCCCc
Confidence            4556899999997655  57788999999999999874


No 50 
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=91.08  E-value=0.11  Score=52.65  Aligned_cols=29  Identities=21%  Similarity=0.304  Sum_probs=21.7

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCCceeee
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      |---+.|++||| .+|.   ...||.||+.+.+
T Consensus       623 n~~~~~C~~CG~-~~g~---~~~CP~CG~~~~v  651 (656)
T PRK08270        623 TPTFSICPKHGY-LSGE---HEFCPKCGEETEV  651 (656)
T ss_pred             CCCCcccCCCCC-cCCC---CCCCcCCcCccce
Confidence            344588999998 4454   5899999988543


No 51 
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=90.99  E-value=0.12  Score=45.82  Aligned_cols=30  Identities=30%  Similarity=0.822  Sum_probs=26.5

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCceee
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      +|...|+.|+.+..= .+.+..|||||+.-+
T Consensus       147 VI~A~CsrC~~~L~~-~~~~l~Cp~Cg~tEk  176 (188)
T COG1096         147 VIYARCSRCRAPLVK-KGNMLKCPNCGNTEK  176 (188)
T ss_pred             EEEEEccCCCcceEE-cCcEEECCCCCCEEe
Confidence            567789999999998 999999999998754


No 52 
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=90.84  E-value=0.32  Score=45.83  Aligned_cols=28  Identities=25%  Similarity=0.566  Sum_probs=19.0

Q ss_pred             CCCCCCCcc----ccc-----------cccce-----eecCCCCceee
Q 026283          182 GACPACKRE----FIG-----------SKSQI-----IRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~e----FtG-----------~nnt~-----~~CpnCGe~l~  209 (240)
                      -.||+||-.    +++           ++.+.     ..||+|||++.
T Consensus       240 ~~C~~Cg~~PtiP~~~~~C~HiyCY~Ci~ts~~~~asf~Cp~Cg~~~~  287 (298)
T KOG2879|consen  240 TECPVCGEPPTIPHVIGKCGHIYCYYCIATSRLWDASFTCPLCGENVE  287 (298)
T ss_pred             ceeeccCCCCCCCeeeccccceeehhhhhhhhcchhhcccCccCCCCc
Confidence            479999853    333           33333     38999999886


No 53 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=90.81  E-value=0.11  Score=35.51  Aligned_cols=26  Identities=27%  Similarity=0.687  Sum_probs=20.7

Q ss_pred             cCCCCCCCcccccccc----ceeecCCCCc
Q 026283          181 KGACPACKREFIGSKS----QIIRCAGCGN  206 (240)
Q Consensus       181 eg~CPvC~~eFtG~nn----t~~~CpnCGe  206 (240)
                      +-.|+.|+.+|..+..    ....||.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            4579999999988753    3458999997


No 54 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=90.72  E-value=0.19  Score=33.08  Aligned_cols=29  Identities=28%  Similarity=0.580  Sum_probs=22.1

Q ss_pred             CCCCCCccccccccceeecCCCCceeeee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      .|.-|+.++.=-.+..++||+||--+...
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG~RIlyK   30 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECGHRILYK   30 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS-SEEBE
T ss_pred             CCCcCCCeeEcCCCCcEECCcCCCeEEEe
Confidence            48899999997777889999999766543


No 55 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=90.35  E-value=0.17  Score=43.16  Aligned_cols=26  Identities=27%  Similarity=0.613  Sum_probs=17.7

Q ss_pred             CCCCCCCcccc----------ccccc-eeecCCCCce
Q 026283          182 GACPACKREFI----------GSKSQ-IIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFt----------G~nnt-~~~CpnCGe~  207 (240)
                      +.||-||.++|          |.-.. --|||+||--
T Consensus         1 m~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~   37 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKR   37 (154)
T ss_pred             CcCCCCCCCCCEeEeccccCCCCceeeeeeccccCCc
Confidence            47999998883          32221 2689999853


No 56 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=90.30  E-value=0.23  Score=35.21  Aligned_cols=28  Identities=25%  Similarity=0.736  Sum_probs=23.7

Q ss_pred             CCCCCCccccccccceeecCCCCceeee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      -||.|+.+|-........|+.||-...+
T Consensus        22 fCP~Cg~~~m~~~~~r~~C~~Cgyt~~~   49 (50)
T PRK00432         22 FCPRCGSGFMAEHLDRWHCGKCGYTEFK   49 (50)
T ss_pred             cCcCCCcchheccCCcEECCCcCCEEec
Confidence            7999998888888889999999976543


No 57 
>PRK12496 hypothetical protein; Provisional
Probab=90.29  E-value=0.14  Score=43.36  Aligned_cols=31  Identities=23%  Similarity=0.412  Sum_probs=22.4

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeeeCC
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      -.|+.|+.+|-.-. ..-.||.||.+|.-..-
T Consensus       128 ~~C~gC~~~~~~~~-~~~~C~~CG~~~~r~~~  158 (164)
T PRK12496        128 KVCKGCKKKYPEDY-PDDVCEICGSPVKRKMV  158 (164)
T ss_pred             EECCCCCccccCCC-CCCcCCCCCChhhhcch
Confidence            45999999995422 22479999999865543


No 58 
>PF12773 DZR:  Double zinc ribbon
Probab=90.18  E-value=0.13  Score=34.69  Aligned_cols=26  Identities=23%  Similarity=0.570  Sum_probs=15.6

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .-||.||..+.........||+||+.
T Consensus        13 ~fC~~CG~~l~~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen   13 KFCPHCGTPLPPPDQSKKICPNCGAE   38 (50)
T ss_pred             cCChhhcCChhhccCCCCCCcCCcCC
Confidence            34666666666444445566666665


No 59 
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=90.06  E-value=0.15  Score=51.58  Aligned_cols=24  Identities=33%  Similarity=0.758  Sum_probs=20.4

Q ss_pred             cCCCCCCCccccccccceeecCCCCce
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      -+.|+.||+++.|.   .-.||.||+.
T Consensus       568 ~~~C~~CG~~~~g~---~~~CP~CGs~  591 (625)
T PRK08579        568 ITVCNKCGRSTTGL---YTRCPRCGSE  591 (625)
T ss_pred             CccCCCCCCccCCC---CCcCcCCCCc
Confidence            57899999988777   5799999963


No 60 
>PF12773 DZR:  Double zinc ribbon
Probab=89.70  E-value=0.15  Score=34.41  Aligned_cols=23  Identities=26%  Similarity=0.678  Sum_probs=20.7

Q ss_pred             CCCCCccccccccceeecCCCCceee
Q 026283          184 CPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       184 CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      ||.|+++   +......||+||..|.
T Consensus         1 Cp~Cg~~---~~~~~~fC~~CG~~l~   23 (50)
T PF12773_consen    1 CPHCGTP---NPDDAKFCPHCGTPLP   23 (50)
T ss_pred             CCCcCCc---CCccccCChhhcCChh
Confidence            8999998   6677899999999998


No 61 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=89.32  E-value=0.18  Score=40.91  Aligned_cols=33  Identities=24%  Similarity=0.526  Sum_probs=22.3

Q ss_pred             cCCCCCCCccccccccc------eeecCCCC-ceeeeeCCC
Q 026283          181 KGACPACKREFIGSKSQ------IIRCAGCG-NIVWQPEGD  214 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt------~~~CpnCG-e~l~v~~g~  214 (240)
                      ...| .|+++|.--...      ...||.|| ..+.+..|+
T Consensus        70 ~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs~~~~i~~G~  109 (124)
T PRK00762         70 EIEC-ECGYEGVVDEDEIDHYAAVIECPVCGNKRAHILGGR  109 (124)
T ss_pred             eEEe-eCcCcccccccchhccccCCcCcCCCCCCCEEecCC
Confidence            3469 999987643211      25799999 567777765


No 62 
>PHA02942 putative transposase; Provisional
Probab=88.56  E-value=0.33  Score=46.02  Aligned_cols=28  Identities=21%  Similarity=0.675  Sum_probs=22.6

Q ss_pred             cCCCCCCCccccccccceeecCCCCcee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      .-.||+||+.-.-+.+....||+||-..
T Consensus       325 Sq~Cs~CG~~~~~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        325 SVSCPKCGHKMVEIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CccCCCCCCccCcCCCCEEECCCCCCEe
Confidence            3569999987666667889999999754


No 63 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=87.84  E-value=0.31  Score=40.22  Aligned_cols=28  Identities=21%  Similarity=0.498  Sum_probs=25.0

Q ss_pred             CCCCCCCccccccccceeecCCCCceee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      -.||.|+.|||=-.+....||-||..-.
T Consensus         3 p~CP~C~seytY~dg~~~iCpeC~~EW~   30 (109)
T TIGR00686         3 PPCPKCNSEYTYHDGTQLICPSCLYEWN   30 (109)
T ss_pred             CcCCcCCCcceEecCCeeECcccccccc
Confidence            4799999999999999999999997643


No 64 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=87.74  E-value=0.63  Score=42.57  Aligned_cols=28  Identities=29%  Similarity=0.663  Sum_probs=21.8

Q ss_pred             CCCCCCCcccc--ccccceeecCCCCceee
Q 026283          182 GACPACKREFI--GSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFt--G~nnt~~~CpnCGe~l~  209 (240)
                      ..||.||..=+  =+.+....|.+||-+|.
T Consensus        12 ~~Cp~Cg~~~iv~d~~~Ge~vC~~CG~Vl~   41 (310)
T PRK00423         12 LVCPECGSDKLIYDYERGEIVCADCGLVIE   41 (310)
T ss_pred             CcCcCCCCCCeeEECCCCeEeecccCCccc
Confidence            46999997322  45678999999999885


No 65 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=87.67  E-value=0.37  Score=30.64  Aligned_cols=25  Identities=24%  Similarity=0.519  Sum_probs=11.7

Q ss_pred             CCCCCCcccccccc-ceeecCCCCce
Q 026283          183 ACPACKREFIGSKS-QIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nn-t~~~CpnCGe~  207 (240)
                      -||.||.+-.=... ..-+||+||..
T Consensus         5 fC~~CG~~t~~~~~g~~r~C~~Cg~~   30 (32)
T PF09297_consen    5 FCGRCGAPTKPAPGGWARRCPSCGHE   30 (32)
T ss_dssp             B-TTT--BEEE-SSSS-EEESSSS-E
T ss_pred             ccCcCCccccCCCCcCEeECCCCcCE
Confidence            37777766554443 56677777754


No 66 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=87.33  E-value=1.8  Score=41.47  Aligned_cols=28  Identities=21%  Similarity=0.612  Sum_probs=21.9

Q ss_pred             CCCCCCccccccccceeecCCCCceeeeeC
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      .||.|+....  .+++.+||.||..|.-.+
T Consensus       217 ~C~~Cd~~~~--~~~~a~CpRC~~~L~~~~  244 (403)
T TIGR00155       217 SCSACHTTIL--PAQEPVCPRCSTPLYVRR  244 (403)
T ss_pred             cCCCCCCccC--CCCCcCCcCCCCcccCCC
Confidence            4999998553  477889999999995443


No 68 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=87.09  E-value=0.3  Score=41.04  Aligned_cols=32  Identities=19%  Similarity=0.242  Sum_probs=28.0

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeeeCCCc
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~F  215 (240)
                      -.||.||+.|--+|...+.||-||+..  |..-|
T Consensus        10 ridPetg~KFYDLNrdPiVsPytG~s~--P~s~f   41 (129)
T COG4530          10 RIDPETGKKFYDLNRDPIVSPYTGKSY--PRSYF   41 (129)
T ss_pred             ccCccccchhhccCCCccccCcccccc--hHHHH
Confidence            469999999999999999999999976  65555


No 69 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=86.80  E-value=0.18  Score=35.15  Aligned_cols=14  Identities=43%  Similarity=0.937  Sum_probs=7.2

Q ss_pred             hcCCCCCCCccccc
Q 026283          180 IKGACPACKREFIG  193 (240)
Q Consensus       180 Ieg~CPvC~~eFtG  193 (240)
                      .++.||||+++|+.
T Consensus        19 ~~~~CPlC~r~l~~   32 (54)
T PF04423_consen   19 AKGCCPLCGRPLDE   32 (54)
T ss_dssp             -SEE-TTT--EE-H
T ss_pred             CCCcCCCCCCCCCH
Confidence            44589999999864


No 70 
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=86.78  E-value=0.48  Score=34.70  Aligned_cols=35  Identities=26%  Similarity=0.671  Sum_probs=23.9

Q ss_pred             hcCCCCCCCcccccc--ccceeecCCCCceeeeeCCC
Q 026283          180 IKGACPACKREFIGS--KSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~--nnt~~~CpnCGe~l~v~~g~  214 (240)
                      +.-.||.|+++=+=|  -++...|.+||.+|-+|-|.
T Consensus         6 m~VkCp~C~~~q~vFSha~t~V~C~~Cg~~L~~PtGG   42 (55)
T PF01667_consen    6 MDVKCPGCYNIQTVFSHAQTVVKCVVCGTVLAQPTGG   42 (55)
T ss_dssp             EEEE-TTT-SEEEEETT-SS-EE-SSSTSEEEEE-SS
T ss_pred             EEEECCCCCCeeEEEecCCeEEEcccCCCEecCCCCc
Confidence            456899999987655  46778999999999999874


No 71 
>PF14257 DUF4349:  Domain of unknown function (DUF4349)
Probab=86.34  E-value=2.9  Score=36.79  Aligned_cols=32  Identities=19%  Similarity=0.146  Sum_probs=19.0

Q ss_pred             cchhHHHHhhhchhHHHHHHHHhhHHHHHhHH
Q 026283           34 SDFDRFARRMTSGEAWRDAWRTANNGFEQLVF   65 (240)
Q Consensus        34 ~d~d~~a~~~~~~~a~r~a~r~an~~~e~~~f   65 (240)
                      ..||.|...+.+..-...---++.|-.+++..
T Consensus       105 ~~~~~~l~~l~~~g~v~~~~~~~~DvT~~y~D  136 (262)
T PF14257_consen  105 DKFDSFLDELSELGKVTSRNISSEDVTEQYVD  136 (262)
T ss_pred             HHHHHHHHHHhccCceeeeeccccchHHHHHH
Confidence            56777877776443444444556666666543


No 72 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=86.00  E-value=0.45  Score=33.35  Aligned_cols=30  Identities=33%  Similarity=0.805  Sum_probs=22.4

Q ss_pred             hhcCCCCCCCccccc-------cccceeecCCCCcee
Q 026283          179 VIKGACPACKREFIG-------SKSQIIRCAGCGNIV  208 (240)
Q Consensus       179 LIeg~CPvC~~eFtG-------~nnt~~~CpnCGe~l  208 (240)
                      +..+.|-.|..+..-       -.+....|||||-+|
T Consensus        20 v~~~~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   20 VEGGTCSGCHMELPPQELNEIRKGDEIVFCPNCGRIL   56 (56)
T ss_pred             eeCCccCCCCEEcCHHHHHHHHcCCCeEECcCCCccC
Confidence            567889999876542       225789999999775


No 73 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=86.00  E-value=0.4  Score=32.33  Aligned_cols=28  Identities=29%  Similarity=0.647  Sum_probs=20.8

Q ss_pred             cCCCCCCCccccccc----cceeecCCCCc-ee
Q 026283          181 KGACPACKREFIGSK----SQIIRCAGCGN-IV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG~n----nt~~~CpnCGe-~l  208 (240)
                      +=.|+.||.+|.=+-    .....||.||. .+
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~~~   37 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSISEDDPVPCPECGSTEV   37 (42)
T ss_pred             EEEeCCCCCEEEEEEEcCCCCCCcCCCCCCCce
Confidence            457999998875432    36789999998 44


No 74 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=85.92  E-value=0.4  Score=43.08  Aligned_cols=29  Identities=31%  Similarity=0.847  Sum_probs=22.2

Q ss_pred             hcCCCCCCCcccc-------ccccceeecCCCCcee
Q 026283          180 IKGACPACKREFI-------GSKSQIIRCAGCGNIV  208 (240)
Q Consensus       180 Ieg~CPvC~~eFt-------G~nnt~~~CpnCGe~l  208 (240)
                      |...||.|+.|=+       +-++--.+|++||..-
T Consensus         5 iy~~Cp~Cg~eev~hEVik~~g~~~lvrC~eCG~V~   40 (201)
T COG1326           5 IYIECPSCGSEEVSHEVIKERGREPLVRCEECGTVH   40 (201)
T ss_pred             EEEECCCCCcchhhHHHHHhcCCceEEEccCCCcEe
Confidence            5678999996665       3444688999999764


No 75 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=85.82  E-value=0.5  Score=31.42  Aligned_cols=32  Identities=34%  Similarity=0.895  Sum_probs=22.0

Q ss_pred             CCCCCCcccccccc---ceeecCCCCceeeeeCCCc
Q 026283          183 ACPACKREFIGSKS---QIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       183 ~CPvC~~eFtG~nn---t~~~CpnCGe~l~v~~g~F  215 (240)
                      +||.|+.+..-.+-   ..-+||+||-+ |...|.|
T Consensus         1 ~CP~C~~~l~~~~~~~~~id~C~~C~G~-W~d~~el   35 (41)
T PF13453_consen    1 KCPRCGTELEPVRLGDVEIDVCPSCGGI-WFDAGEL   35 (41)
T ss_pred             CcCCCCcccceEEECCEEEEECCCCCeE-EccHHHH
Confidence            69999987665443   44579999864 5555544


No 76 
>PRK10220 hypothetical protein; Provisional
Probab=85.24  E-value=0.59  Score=38.73  Aligned_cols=28  Identities=21%  Similarity=0.570  Sum_probs=24.9

Q ss_pred             CCCCCCCccccccccceeecCCCCceee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      -.||.|+.+||=-.+....||-||..-.
T Consensus         4 P~CP~C~seytY~d~~~~vCpeC~hEW~   31 (111)
T PRK10220          4 PHCPKCNSEYTYEDNGMYICPECAHEWN   31 (111)
T ss_pred             CcCCCCCCcceEcCCCeEECCcccCcCC
Confidence            4799999999999999999999997643


No 77 
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=84.43  E-value=0.69  Score=36.76  Aligned_cols=35  Identities=26%  Similarity=0.680  Sum_probs=28.9

Q ss_pred             hcCCCCCCCcccccc--ccceeecCCCCceeeeeCCC
Q 026283          180 IKGACPACKREFIGS--KSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~--nnt~~~CpnCGe~l~v~~g~  214 (240)
                      +.-.||.|+++=+=|  -+++..|.+||.+|-+|-|.
T Consensus        34 m~VkCp~C~n~q~VFShA~t~V~C~~Cg~~L~~PTGG   70 (85)
T PTZ00083         34 MDVKCPGCSQITTVFSHAQTVVLCGGCSSQLCQPTGG   70 (85)
T ss_pred             EEEECCCCCCeeEEEecCceEEEccccCCEeeccCCC
Confidence            455799999997755  46788999999999999874


No 78 
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=84.41  E-value=0.59  Score=39.12  Aligned_cols=28  Identities=36%  Similarity=1.026  Sum_probs=22.8

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeeeCCCc
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~F  215 (240)
                      ..||||+.+.+   -|...|+||+.-|   .|.|
T Consensus         7 ~~cPvcg~~~i---VTeL~c~~~etTV---rg~F   34 (122)
T COG3877           7 NRCPVCGRKLI---VTELKCSNCETTV---RGNF   34 (122)
T ss_pred             CCCCcccccce---eEEEecCCCCceE---ecce
Confidence            47999999865   6889999999765   4667


No 79 
>PLN00209 ribosomal protein S27; Provisional
Probab=84.35  E-value=0.67  Score=36.87  Aligned_cols=35  Identities=20%  Similarity=0.541  Sum_probs=29.0

Q ss_pred             hcCCCCCCCcccccc--ccceeecCCCCceeeeeCCC
Q 026283          180 IKGACPACKREFIGS--KSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~--nnt~~~CpnCGe~l~v~~g~  214 (240)
                      +.-.||.|+++=+=|  -+++..|.+||.+|-+|-|.
T Consensus        35 m~VkCp~C~n~q~VFShA~t~V~C~~Cg~~L~~PTGG   71 (86)
T PLN00209         35 MDVKCQGCFNITTVFSHSQTVVVCGSCQTVLCQPTGG   71 (86)
T ss_pred             EEEECCCCCCeeEEEecCceEEEccccCCEeeccCCC
Confidence            456899999997655  46788999999999999874


No 80 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=84.11  E-value=0.5  Score=34.65  Aligned_cols=25  Identities=28%  Similarity=0.634  Sum_probs=19.6

Q ss_pred             CCCCCCccccccccceeecCCCCceeeeeC
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      .||.|+--..     ..+||.||++.....
T Consensus         7 ~C~~CgvYTL-----k~~CP~CG~~t~~~~   31 (56)
T PRK13130          7 KCPKCGVYTL-----KEICPVCGGKTKNPH   31 (56)
T ss_pred             ECCCCCCEEc-----cccCcCCCCCCCCCC
Confidence            5999986444     678999999977665


No 81 
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=84.09  E-value=0.52  Score=44.48  Aligned_cols=29  Identities=24%  Similarity=0.607  Sum_probs=19.1

Q ss_pred             hhhhcCCCCCCCccccccccceeecCCCCceee
Q 026283          177 NFVIKGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      ..-|+|.||.|+++-..    .-+|.+||.++.
T Consensus       132 e~~v~g~CP~C~~~~a~----g~~Ce~cG~~~~  160 (391)
T PF09334_consen  132 ESFVEGTCPYCGSDKAR----GDQCENCGRPLE  160 (391)
T ss_dssp             GGGETCEETTT--SSCT----TTEETTTSSBEE
T ss_pred             cceeeccccCcCccccC----CCcccCCCCCcc
Confidence            34488999999965332    247888888776


No 82 
>PRK11827 hypothetical protein; Provisional
Probab=83.81  E-value=0.82  Score=33.97  Aligned_cols=32  Identities=22%  Similarity=0.318  Sum_probs=25.8

Q ss_pred             CCCCCCCcccccc-ccceeecCCCCceeeeeCC
Q 026283          182 GACPACKREFIGS-KSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~eFtG~-nnt~~~CpnCGe~l~v~~g  213 (240)
                      -.||+|+-++.=- ..+...|..||-.--|.+|
T Consensus         9 LaCP~ckg~L~~~~~~~~Lic~~~~laYPI~dg   41 (60)
T PRK11827          9 IACPVCNGKLWYNQEKQELICKLDNLAFPLRDG   41 (60)
T ss_pred             eECCCCCCcCeEcCCCCeEECCccCeeccccCC
Confidence            4799999988732 3567999999988888776


No 83 
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=83.79  E-value=0.6  Score=40.10  Aligned_cols=21  Identities=33%  Similarity=0.838  Sum_probs=14.4

Q ss_pred             CCCCCccccccccc---------------eeecCCCCc
Q 026283          184 CPACKREFIGSKSQ---------------IIRCAGCGN  206 (240)
Q Consensus       184 CPvC~~eFtG~nnt---------------~~~CpnCGe  206 (240)
                      ||||+.+  +++..               -..|++||-
T Consensus         1 CP~Cg~~--~~~~~~~~~~IP~F~evii~sf~C~~CGy   36 (163)
T TIGR00340         1 CPVCGSR--TLKAVTYDYDIPYFGKIMLSTYICEKCGY   36 (163)
T ss_pred             CCCCCCc--ceEeeeEeccCCCcceEEEEEEECCCCCC
Confidence            8999876  33331               457999984


No 84 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=83.42  E-value=0.8  Score=36.63  Aligned_cols=30  Identities=33%  Similarity=0.750  Sum_probs=23.9

Q ss_pred             cCCCCCCCccccccccc---eeecCCCCceeee
Q 026283          181 KGACPACKREFIGSKSQ---IIRCAGCGNIVWQ  210 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt---~~~CpnCGe~l~v  210 (240)
                      .-.|+.|+.++..-+..   ...|+.||.+|.+
T Consensus       123 ~~~C~~C~~~~~r~~~~~~~~~~C~~C~~~l~~  155 (157)
T PF10263_consen  123 VYRCPSCGREYKRHRRSKRKRYRCGRCGGPLVQ  155 (157)
T ss_pred             EEEcCCCCCEeeeecccchhhEECCCCCCEEEE
Confidence            44699999998877774   5579999998875


No 85 
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=82.96  E-value=0.55  Score=46.46  Aligned_cols=45  Identities=24%  Similarity=0.256  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHhhhhh--------cCCCCCCCccccccccceeecCCCCce-eeee
Q 026283          163 LPIAAPLLIGTVANNFVI--------KGACPACKREFIGSKSQIIRCAGCGNI-VWQP  211 (240)
Q Consensus       163 lPvaap~li~wWlkRnLI--------eg~CPvC~~eFtG~nnt~~~CpnCGe~-l~v~  211 (240)
                      -|=++--++....++.-|        -+.|+.|||.-.+    .-.||.||+. +.+=
T Consensus       465 n~~al~~lv~~~~~~~~i~Y~~in~~~~~C~~CG~~~~~----~~~CP~CGs~~~~~~  518 (546)
T PF13597_consen  465 NPEALEKLVRYAMENTGIPYFTINPPIDICPDCGYIGGE----GDKCPKCGSENIEVY  518 (546)
T ss_dssp             -HHHHHHHHHHHHH--H-SEEEEE--EEEETTT---S------EEE-CCC----EEEE
T ss_pred             CHHHHHHHHHHHHHhCCCCeEEEecCcccccCCCcCCCC----CCCCCCCCCcccceE
Confidence            344444445555553322        3789999986544    7789999998 5543


No 86 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=82.81  E-value=0.92  Score=33.25  Aligned_cols=30  Identities=27%  Similarity=0.656  Sum_probs=23.8

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCCcee
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      |-....||+|+..|+ -.....+||-||.+.
T Consensus         2 ~~~~~~C~~Cg~~~~-~~dDiVvCp~Cgapy   31 (54)
T PF14446_consen    2 NYEGCKCPVCGKKFK-DGDDIVVCPECGAPY   31 (54)
T ss_pred             CccCccChhhCCccc-CCCCEEECCCCCCcc
Confidence            345678999999996 235788999999875


No 87 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=82.78  E-value=0.77  Score=29.80  Aligned_cols=11  Identities=27%  Similarity=0.791  Sum_probs=8.6

Q ss_pred             eecCCCCceee
Q 026283          199 IRCAGCGNIVW  209 (240)
Q Consensus       199 ~~CpnCGe~l~  209 (240)
                      ..|++|||.+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            36999999865


No 88 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=82.74  E-value=0.8  Score=37.62  Aligned_cols=35  Identities=31%  Similarity=0.881  Sum_probs=26.3

Q ss_pred             hcCCCCCCCccccccccc----------------eeecCCCCceeeeeCCCc
Q 026283          180 IKGACPACKREFIGSKSQ----------------IIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt----------------~~~CpnCGe~l~v~~g~F  215 (240)
                      +...||.|+.++.-....                -.+||+||.+-|. +.|+
T Consensus        90 ~~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~-GsH~  140 (147)
T PF01927_consen   90 IFSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWE-GSHW  140 (147)
T ss_pred             CCCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecc-cccH
Confidence            346899999988766444                5699999999984 4443


No 89 
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional
Probab=82.57  E-value=0.48  Score=48.40  Aligned_cols=39  Identities=26%  Similarity=0.612  Sum_probs=30.5

Q ss_pred             hhcCCCCCCCccccccccceeecCC--CCceeeeeCCCcccC
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAG--CGNIVWQPEGDFFSR  218 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~Cpn--CGe~l~v~~g~F~s~  218 (240)
                      .+-..||+|+.+.+- ++...+|+|  |-..+...=-||.|+
T Consensus       396 ~~P~~CP~C~s~l~~-~~~~~~C~n~~C~aq~~~~i~hf~sr  436 (669)
T PRK14350        396 KIPDNCPSCKTALIK-EGAHLFCVNNHCPSVIVERIKYFCSK  436 (669)
T ss_pred             CCCCCCCCCCCEeee-CCEEEEECCCCCHHHHHhhhheeccC
Confidence            356799999999875 567899986  988887766788554


No 90 
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=82.09  E-value=0.75  Score=46.74  Aligned_cols=24  Identities=25%  Similarity=0.431  Sum_probs=19.1

Q ss_pred             hcCCCCCCCccccccccceeecCCCCc
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      --+.||+|||..+|   ..-.||.||+
T Consensus       565 ~~~iC~~CG~~~~g---~~~~CP~CGs  588 (623)
T PRK08271        565 KITICNDCHHIDKR---TGKRCPICGS  588 (623)
T ss_pred             CCccCCCCCCcCCC---CCcCCcCCCC
Confidence            34789999997555   3589999995


No 91 
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=82.01  E-value=0.63  Score=45.92  Aligned_cols=35  Identities=23%  Similarity=0.648  Sum_probs=27.7

Q ss_pred             hhcCCCCCCCccccccc------c--ceeecCCCCceeeeeCC
Q 026283          179 VIKGACPACKREFIGSK------S--QIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~n------n--t~~~CpnCGe~l~v~~g  213 (240)
                      .-.--||+|+..|+.|.      +  ....|-+||..|.....
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~gelveDe~  168 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGELVEDEN  168 (436)
T ss_pred             cccccCCccccchhhhHHHHhhcccCceEEEecCCCchhcccc
Confidence            33447999999999873      3  67899999999976654


No 92 
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=82.00  E-value=0.7  Score=46.80  Aligned_cols=26  Identities=27%  Similarity=0.477  Sum_probs=19.0

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCCce
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      |---+.|+.|||  .|--  ...||.||+.
T Consensus       556 n~~~~~C~~CGy--~g~~--~~~CP~CG~~  581 (618)
T PRK14704        556 NHPVDRCKCCSY--HGVI--GNECPSCGNE  581 (618)
T ss_pred             CCCCeecCCCCC--CCCc--CccCcCCCCC
Confidence            445578999998  4432  3789999964


No 93 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=81.92  E-value=0.75  Score=50.54  Aligned_cols=9  Identities=44%  Similarity=1.198  Sum_probs=6.3

Q ss_pred             CCCCCCCcc
Q 026283          182 GACPACKRE  190 (240)
Q Consensus       182 g~CPvC~~e  190 (240)
                      -.||.||.+
T Consensus       668 rkCPkCG~~  676 (1337)
T PRK14714        668 RRCPSCGTE  676 (1337)
T ss_pred             EECCCCCCc
Confidence            468887775


No 94 
>PRK08402 replication factor A; Reviewed
Probab=81.67  E-value=0.71  Score=43.87  Aligned_cols=30  Identities=23%  Similarity=0.624  Sum_probs=23.8

Q ss_pred             hhhhcCCCCCCCcccc-ccccceeecCCCCc
Q 026283          177 NFVIKGACPACKREFI-GSKSQIIRCAGCGN  206 (240)
Q Consensus       177 RnLIeg~CPvC~~eFt-G~nnt~~~CpnCGe  206 (240)
                      .+.+.-+||.|++.++ --.+..-+|++||+
T Consensus       208 ~~~~y~aCp~CnKkv~~~~~~~~~~Ce~~~~  238 (355)
T PRK08402        208 RVLVYDACPECRRKVDYDPATDTWICPEHGE  238 (355)
T ss_pred             cCeeEecCCCCCeEEEEecCCCCEeCCCCCC
Confidence            3667889999999987 44445679999995


No 95 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=81.53  E-value=2  Score=40.50  Aligned_cols=10  Identities=30%  Similarity=0.893  Sum_probs=8.6

Q ss_pred             cCCCCCCCcc
Q 026283          181 KGACPACKRE  190 (240)
Q Consensus       181 eg~CPvC~~e  190 (240)
                      .+.|||||..
T Consensus       187 ~~~CPvCGs~  196 (309)
T PRK03564        187 RQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCc
Confidence            4899999987


No 96 
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=81.21  E-value=0.83  Score=46.88  Aligned_cols=25  Identities=28%  Similarity=0.594  Sum_probs=17.4

Q ss_pred             hcCCCCCCCcccccccc---ceeecCCCCc
Q 026283          180 IKGACPACKREFIGSKS---QIIRCAGCGN  206 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nn---t~~~CpnCGe  206 (240)
                      --+.|++|||  .|--+   ..-.||+||+
T Consensus       640 ~~~~C~~CG~--~Ge~~~~~~~~~CP~CG~  667 (711)
T PRK09263        640 PIDECYECGF--TGEFECTEKGFTCPKCGN  667 (711)
T ss_pred             CCcccCCCCC--CccccCCCCCCcCcCCCC
Confidence            3488999998  34331   1268999996


No 97 
>PRK07591 threonine synthase; Validated
Probab=81.13  E-value=1.1  Score=42.59  Aligned_cols=30  Identities=17%  Similarity=0.208  Sum_probs=24.3

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeeeeC
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      .-.|+.|+.+|-- ... .+||.||.+|.+.-
T Consensus        18 ~l~C~~Cg~~~~~-~~~-~~C~~cg~~l~~~y   47 (421)
T PRK07591         18 ALKCRECGAEYPL-GPI-HVCEECFGPLEVAY   47 (421)
T ss_pred             EEEeCCCCCcCCC-CCC-ccCCCCCCeEEEEe
Confidence            4689999999863 333 88999999999884


No 98 
>PRK06450 threonine synthase; Validated
Probab=81.03  E-value=0.92  Score=41.98  Aligned_cols=30  Identities=30%  Similarity=0.506  Sum_probs=23.6

Q ss_pred             hcCCCCCCCccccccccceeecCCCCceeeee
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      |+-.|+.|++++.-  ....+||.||.+|.+.
T Consensus         2 ~~~~C~~Cg~~~~~--~~~~~C~~cg~~l~~~   31 (338)
T PRK06450          2 VKEVCMKCGKERES--IYEIRCKKCGGPFEIL   31 (338)
T ss_pred             ceeEECCcCCcCCC--cccccCCcCCCEeEEe
Confidence            44589999999843  3357899999988876


No 99 
>cd07973 Spt4 Transcription elongation factor Spt4. Spt4 is a transcription elongation factor. Three transcription-elongation factors Spt4, Spt5, and Spt6, are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles.   Spt4 functions entirely in the context of the Spt4-Spt5 heterodimer and it has been found only as a complex to Spt5 in Yeast and Human. Spt4 is a small protein that has zinc finger at the N-terminus.   Spt5 is a large protein that has several interesting structural features of an acidic N-terminus, a single NGN domain, five or six KOW domains, and a set of simple C-termianl repeats. Spt4 binds to Spt5 NGN domain. Unlike Spt5, Spt4 is not essential for viability in yeast, however Spt4 is critical for normal function of the Spt4-Spt5 compl
Probab=80.80  E-value=0.85  Score=36.56  Aligned_cols=32  Identities=16%  Similarity=0.249  Sum_probs=22.5

Q ss_pred             CCCCCCccccccccceeecCCCCceeeeeCCC
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      +|-.|++=-+.=.-....|||||..|..++++
T Consensus         5 AC~~C~~I~~~~qf~~~gCpnC~~~l~~~g~~   36 (98)
T cd07973           5 ACLLCSLIKTEDQFERDGCPNCEGYLDMKGNH   36 (98)
T ss_pred             hhccCCcccccccccCCCCCCCcchhccCCCc
Confidence            79999876543222236899999888777765


No 100
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=80.62  E-value=0.87  Score=30.08  Aligned_cols=18  Identities=28%  Similarity=0.713  Sum_probs=16.2

Q ss_pred             eeecCCCCceeeeeCCCc
Q 026283          198 IIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g~F  215 (240)
                      .++||||+....+++.+.
T Consensus         2 ~i~CP~C~~~f~v~~~~l   19 (37)
T PF13719_consen    2 IITCPNCQTRFRVPDDKL   19 (37)
T ss_pred             EEECCCCCceEEcCHHHc
Confidence            479999999999999876


No 101
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=80.61  E-value=1  Score=30.01  Aligned_cols=27  Identities=26%  Similarity=0.706  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccccceeecCCCCcee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      ..||+|+..+.=.+.-...|-.||.+.
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~~~   35 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGHQS   35 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCceEc
Confidence            348899888877788888888888754


No 102
>PRK07218 replication factor A; Provisional
Probab=80.34  E-value=0.84  Score=44.42  Aligned_cols=24  Identities=29%  Similarity=0.643  Sum_probs=19.2

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCce
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .+-..||.|++-.     +.-+||.||++
T Consensus       295 gli~rCP~C~r~v-----~~~~C~~hG~v  318 (423)
T PRK07218        295 GLIERCPECGRVI-----QKGQCRSHGAV  318 (423)
T ss_pred             cceecCcCccccc-----cCCcCCCCCCc
Confidence            3445899999988     44799999986


No 103
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=80.20  E-value=0.96  Score=37.56  Aligned_cols=26  Identities=23%  Similarity=0.689  Sum_probs=23.9

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      -.||-|+.|+|==.+.+..||.|+.+
T Consensus         4 p~cp~c~sEytYed~~~~~cpec~~e   29 (112)
T COG2824           4 PPCPKCNSEYTYEDGGQLICPECAHE   29 (112)
T ss_pred             CCCCccCCceEEecCceEeCchhccc
Confidence            36999999999999999999999976


No 104
>PRK04023 DNA polymerase II large subunit; Validated
Probab=80.01  E-value=0.9  Score=49.10  Aligned_cols=20  Identities=40%  Similarity=0.938  Sum_probs=16.8

Q ss_pred             CCCCCCccccccccceeecCCCCce
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .||.||.+.     ...+||+||+.
T Consensus       628 fCpsCG~~t-----~~frCP~CG~~  647 (1121)
T PRK04023        628 KCPSCGKET-----FYRRCPFCGTH  647 (1121)
T ss_pred             cCCCCCCcC-----CcccCCCCCCC
Confidence            799999984     56789999986


No 105
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=79.78  E-value=1.3  Score=29.49  Aligned_cols=24  Identities=33%  Similarity=0.915  Sum_probs=9.0

Q ss_pred             CCCCCccc-----cccccceeecCCCCce
Q 026283          184 CPACKREF-----IGSKSQIIRCAGCGNI  207 (240)
Q Consensus       184 CPvC~~eF-----tG~nnt~~~CpnCGe~  207 (240)
                      ||.||.+.     .|=+..-..||+||.+
T Consensus         3 C~~CG~~l~~~ip~gd~r~R~vC~~Cg~I   31 (34)
T PF14803_consen    3 CPQCGGPLERRIPEGDDRERLVCPACGFI   31 (34)
T ss_dssp             -TTT--B-EEE--TT-SS-EEEETTTTEE
T ss_pred             cccccChhhhhcCCCCCccceECCCCCCE
Confidence            55555543     2334444555666544


No 106
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=79.66  E-value=0.9  Score=30.31  Aligned_cols=30  Identities=27%  Similarity=0.520  Sum_probs=21.7

Q ss_pred             CCCCCCccccccccc---eeecCCCCceeeeeC
Q 026283          183 ACPACKREFIGSKSQ---IIRCAGCGNIVWQPE  212 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt---~~~CpnCGe~l~v~~  212 (240)
                      .||.||.-|-=..+.   .-.|.+||+.|.|..
T Consensus         3 ~C~~Cg~~Yh~~~~pP~~~~~Cd~cg~~L~qR~   35 (36)
T PF05191_consen    3 ICPKCGRIYHIEFNPPKVEGVCDNCGGELVQRK   35 (36)
T ss_dssp             EETTTTEEEETTTB--SSTTBCTTTTEBEBEEG
T ss_pred             CcCCCCCccccccCCCCCCCccCCCCCeeEeCC
Confidence            489999877654443   567999999887753


No 107
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=79.37  E-value=1.1  Score=45.45  Aligned_cols=25  Identities=24%  Similarity=0.650  Sum_probs=17.8

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCc
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      .--+.||+||| .+|-  ..-.||.||+
T Consensus       530 ~~~siC~~CGy-~~g~--~~~~CP~CGs  554 (586)
T TIGR02827       530 IKITICNDCHH-IDKR--TLHRCPVCGS  554 (586)
T ss_pred             CCCeecCCCCC-cCCC--cCCcCcCCCC
Confidence            34478999998 3331  2379999994


No 108
>PRK06386 replication factor A; Reviewed
Probab=79.09  E-value=0.99  Score=43.18  Aligned_cols=23  Identities=17%  Similarity=0.354  Sum_probs=18.6

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCc
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      .+-..||.|++-..  +   -+||.||+
T Consensus       234 gli~rCP~C~R~l~--~---g~C~~HG~  256 (358)
T PRK06386        234 RIFTKCSVCNKIIE--D---GVCKDHPD  256 (358)
T ss_pred             EeEecCcCCCeEcc--C---CcCCCCCC
Confidence            44568999999988  2   39999998


No 109
>PRK06260 threonine synthase; Validated
Probab=78.95  E-value=1.4  Score=41.17  Aligned_cols=29  Identities=24%  Similarity=0.577  Sum_probs=23.1

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      -.|+.|+.++- .+.....||.||.+|.+.
T Consensus         4 ~~C~~cg~~~~-~~~~~~~Cp~cg~~l~~~   32 (397)
T PRK06260          4 LKCIECGKEYD-PDEIIYTCPECGGLLEVI   32 (397)
T ss_pred             EEECCCCCCCC-CCCccccCCCCCCeEEEE
Confidence            47999999985 344457899999998876


No 110
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=78.85  E-value=1.1  Score=46.14  Aligned_cols=22  Identities=27%  Similarity=0.582  Sum_probs=16.5

Q ss_pred             cCCCCCCCccccccccceeecCCCCc
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      -+.||+|||.. |+   .-.||.||+
T Consensus       680 ~~~C~~CG~~~-~~---~~~CP~CG~  701 (735)
T PRK07111        680 VDRCPVCGYLG-VI---EDKCPKCGS  701 (735)
T ss_pred             CeecCCCCCCC-Cc---CccCcCCCC
Confidence            37899999632 33   379999995


No 111
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=78.80  E-value=1.1  Score=36.71  Aligned_cols=33  Identities=24%  Similarity=0.528  Sum_probs=26.9

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCCceeee
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      ++...+||.|+...+-.......|++|++.+..
T Consensus        31 ~~~Y~aC~~C~kkv~~~~~~~~~C~~C~~~~~~   63 (166)
T cd04476          31 NWWYPACPGCNKKVVEEGNGTYRCEKCNKSVPN   63 (166)
T ss_pred             CeEEccccccCcccEeCCCCcEECCCCCCcCCC
Confidence            567789999999988665588999999998533


No 112
>PF14768 RPA_interact_C:  Replication protein A interacting C-terminal
Probab=78.07  E-value=2  Score=32.60  Aligned_cols=27  Identities=30%  Similarity=0.866  Sum_probs=22.1

Q ss_pred             CCCCCccccccccceeecCCCCceeeeeCC
Q 026283          184 CPACKREFIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       184 CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      ||||+..--..++..+.| .||  |.++-+
T Consensus         2 CPVC~~~~L~~~~~~i~C-~Cg--l~l~~~   28 (82)
T PF14768_consen    2 CPVCQKGNLRENSNVISC-SCG--LRLNTQ   28 (82)
T ss_pred             CCccCCCcccccCCeEEC-CCc--cEEecC
Confidence            999999999999999999 566  555443


No 113
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=77.93  E-value=0.9  Score=39.73  Aligned_cols=36  Identities=28%  Similarity=0.721  Sum_probs=26.6

Q ss_pred             hhcCCCCCCCccccccccce----------------eecCCCCceeeeeCCCc
Q 026283          179 VIKGACPACKREFIGSKSQI----------------IRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~----------------~~CpnCGe~l~v~~g~F  215 (240)
                      .....||.|+-+..=..-..                .+||+||.+-|. ++|+
T Consensus        95 ~e~~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW~-GsHw  146 (165)
T COG1656          95 PEFSRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYWK-GSHW  146 (165)
T ss_pred             cccccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccccC-chHH
Confidence            44689999999887655444                349999999884 4454


No 114
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=77.92  E-value=1.9  Score=31.97  Aligned_cols=32  Identities=22%  Similarity=0.361  Sum_probs=24.9

Q ss_pred             CCCCCCc-------cccccccceeecCCCCceeeeeCCC
Q 026283          183 ACPACKR-------EFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       183 ~CPvC~~-------eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      -||+||+       +=|-++|=...||.|-..--+.-.+
T Consensus         6 ~CP~CgnKTR~kir~DT~LkNfPlyCpKCK~EtlI~v~~   44 (55)
T PF14205_consen    6 LCPICGNKTRLKIREDTVLKNFPLYCPKCKQETLIDVKQ   44 (55)
T ss_pred             ECCCCCCccceeeecCceeccccccCCCCCceEEEEeec
Confidence            4999994       5688999999999998765554333


No 115
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=77.92  E-value=1.1  Score=33.56  Aligned_cols=22  Identities=32%  Similarity=0.551  Sum_probs=16.8

Q ss_pred             CCCCCCCccccccccceeecCCCCcee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      .+|..|++=-.     ..+|||||..-
T Consensus         4 kAC~~C~~i~~-----~~~CP~Cgs~~   25 (61)
T PRK08351          4 KACRHCHYITT-----EDRCPVCGSRD   25 (61)
T ss_pred             hhhhhCCcccC-----CCcCCCCcCCc
Confidence            48999998663     33799999854


No 116
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=77.74  E-value=1.5  Score=29.84  Aligned_cols=28  Identities=25%  Similarity=0.668  Sum_probs=23.0

Q ss_pred             CCCCCCCccccccccceeecCCCCceeee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      ..|+.|+.+|.- ....-.|.+||+++=-
T Consensus         3 ~~C~~C~~~F~~-~~rk~~Cr~Cg~~~C~   30 (57)
T cd00065           3 SSCMGCGKPFTL-TRRRHHCRNCGRIFCS   30 (57)
T ss_pred             CcCcccCccccC-CccccccCcCcCCcCh
Confidence            579999999876 5577899999998643


No 117
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=77.53  E-value=2.5  Score=28.39  Aligned_cols=31  Identities=26%  Similarity=0.497  Sum_probs=20.9

Q ss_pred             CCCCCCcccccc--c-cceeecCCCCceeeeeCC
Q 026283          183 ACPACKREFIGS--K-SQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       183 ~CPvC~~eFtG~--n-nt~~~CpnCGe~l~v~~g  213 (240)
                      -||.||.-..--  + +....||.||-...+...
T Consensus         2 FCp~Cg~~l~~~~~~~~~~~vC~~Cg~~~~~~~~   35 (52)
T smart00661        2 FCPKCGNMLIPKEGKEKRRFVCRKCGYEEPIEQK   35 (52)
T ss_pred             CCCCCCCccccccCCCCCEEECCcCCCeEECCCc
Confidence            499999866432  2 247889999977655443


No 118
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=77.45  E-value=1.5  Score=36.33  Aligned_cols=51  Identities=25%  Similarity=0.385  Sum_probs=36.0

Q ss_pred             HHHHHHHHHHHHHhhhhhcC------------CCCCCCccccccccceeecCCCC-ceeeeeCCC
Q 026283          163 LPIAAPLLIGTVANNFVIKG------------ACPACKREFIGSKSQIIRCAGCG-NIVWQPEGD  214 (240)
Q Consensus       163 lPvaap~li~wWlkRnLIeg------------~CPvC~~eFtG~nnt~~~CpnCG-e~l~v~~g~  214 (240)
                      =|-+.=|.|-...+..+.+|            .|.-|+.++.--..... ||.|| -.+.+-+|+
T Consensus        40 ~~~~l~FaFev~~egT~aega~l~Ie~~p~~~~C~~C~~~~~~e~~~~~-CP~C~s~~~~i~~G~  103 (115)
T COG0375          40 EPEALRFAFEVVAEGTIAEGAELHIEEEPAECWCLDCGQEVELEELDYR-CPKCGSINLRIIGGD  103 (115)
T ss_pred             CHHHHHHHHHHHhccCcccCCEEEEEEeccEEEeccCCCeecchhheeE-CCCCCCCceEEecCC
Confidence            34444555656666666555            59999888887766666 99999 777777775


No 119
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=77.11  E-value=1.3  Score=38.09  Aligned_cols=32  Identities=22%  Similarity=0.737  Sum_probs=22.9

Q ss_pred             hhhcCCCCCCCccccc-------cccceeecCCCCceee
Q 026283          178 FVIKGACPACKREFIG-------SKSQIIRCAGCGNIVW  209 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG-------~nnt~~~CpnCGe~l~  209 (240)
                      ++-+..|..|++++.-       .....-.||+||.+|.
T Consensus       106 ~~~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~lr  144 (218)
T cd01407         106 SLFRVRCTKCGKEYPRDELQADIDREEVPRCPKCGGLLR  144 (218)
T ss_pred             CcCcceeCCCcCCCcHHHHhHhhccCCCCcCCCCCCccC
Confidence            4445689999988752       2345678999998764


No 120
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=76.52  E-value=1.6  Score=32.19  Aligned_cols=26  Identities=27%  Similarity=0.749  Sum_probs=20.1

Q ss_pred             CCCCCCccccccccceeecCCCCceeee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      -||+|+...  =......||.||=+.--
T Consensus         1 ~Cpv~~~~~--~~~v~~~Cp~cGipthc   26 (55)
T PF13824_consen    1 LCPVCKKDL--PAHVNFECPDCGIPTHC   26 (55)
T ss_pred             CCCCCcccc--ccccCCcCCCCCCcCcc
Confidence            399999875  45677899999977543


No 121
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=76.11  E-value=1.3  Score=35.99  Aligned_cols=36  Identities=33%  Similarity=0.664  Sum_probs=27.6

Q ss_pred             hhcCCCCCCCccccccc-cceeecCCCCceeeeeCCCc
Q 026283          179 VIKGACPACKREFIGSK-SQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~n-nt~~~CpnCGe~l~v~~g~F  215 (240)
                      ++-..|-.|||+|--.+ |-..+||-|--. |++.-.|
T Consensus        56 v~Pa~CkkCGfef~~~~ik~pSRCP~CKSE-~Ie~prF   92 (97)
T COG3357          56 VRPARCKKCGFEFRDDKIKKPSRCPKCKSE-WIEEPRF   92 (97)
T ss_pred             ecChhhcccCccccccccCCcccCCcchhh-cccCCce
Confidence            45568999999999843 347899999654 7777666


No 122
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=76.03  E-value=1.5  Score=44.86  Aligned_cols=9  Identities=44%  Similarity=1.080  Sum_probs=4.6

Q ss_pred             ecCCCCcee
Q 026283          200 RCAGCGNIV  208 (240)
Q Consensus       200 ~CpnCGe~l  208 (240)
                      .||+||..+
T Consensus        29 ~Cp~CG~~~   37 (645)
T PRK14559         29 PCPQCGTEV   37 (645)
T ss_pred             cCCCCCCCC
Confidence            455555553


No 123
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=76.03  E-value=1.5  Score=43.68  Aligned_cols=41  Identities=22%  Similarity=0.356  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHHhh-------hhhcCCCCCCCccccccccceeecCCCCce
Q 026283          164 PIAAPLLIGTVANN-------FVIKGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       164 Pvaap~li~wWlkR-------nLIeg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      |=+..=++....+.       |---+.|+.|||  +|-.. .-.||.||+.
T Consensus       500 ~eal~~lv~~a~~~~i~Y~~~n~~~~~C~~CG~--~g~~~-~~~CP~Cgs~  547 (579)
T TIGR02487       500 PEALKDITKKAMKNGIGYFGINPPVDVCEDCGY--TGEGL-NDKCPKCGSH  547 (579)
T ss_pred             HHHHHHHHHHHHhcCCceEEeccCCccCCCCCC--CCCCC-CCcCcCCCCc
Confidence            33434445555555       334578999997  55442 2679999963


No 124
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=75.52  E-value=1.4  Score=35.49  Aligned_cols=35  Identities=26%  Similarity=0.558  Sum_probs=25.1

Q ss_pred             hhhcCCCC--CCCccccccccceeecCCCCceeeeeC
Q 026283          178 FVIKGACP--ACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       178 nLIeg~CP--vC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      ++...+||  .|+.-.+--.+..-+|++|++.+..+.
T Consensus        15 ~~~Y~aC~~~~C~kKv~~~~~~~y~C~~C~~~~~~~~   51 (146)
T PF08646_consen   15 NWYYPACPNEKCNKKVTENGDGSYRCEKCNKTVENPK   51 (146)
T ss_dssp             TTEEEE-TSTTTS-B-EEETTTEEEETTTTEEESS-E
T ss_pred             CcEECCCCCccCCCEeecCCCcEEECCCCCCcCCCee
Confidence            66778999  999988777667889999999874443


No 125
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=75.29  E-value=2  Score=39.75  Aligned_cols=32  Identities=25%  Similarity=0.534  Sum_probs=24.3

Q ss_pred             cCCCCCCCcc--ccccccceeecCCCCceeeeeC
Q 026283          181 KGACPACKRE--FIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       181 eg~CPvC~~e--FtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      ++.||.|+-.  -.=+.+....|-+||.++...-
T Consensus         1 ~~~CpeCg~~~~~~d~~~ge~VC~~CG~Vi~~~~   34 (285)
T COG1405           1 VMSCPECGSTNIITDYERGEIVCADCGLVLEDSL   34 (285)
T ss_pred             CCCCCCCCCccceeeccCCeEEeccCCEEecccc
Confidence            4689999987  1224468999999999987643


No 126
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=75.12  E-value=1.8  Score=41.73  Aligned_cols=27  Identities=15%  Similarity=0.431  Sum_probs=20.7

Q ss_pred             CCCCCCccccccccceeecCCCCceeeeeC
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      .||.|+.-..   +++..||.||..|.-..
T Consensus       223 ~C~~Cd~l~~---~~~a~CpRC~~~L~~~~  249 (419)
T PRK15103        223 SCSCCTAILP---ADQPVCPRCHTKGYVRR  249 (419)
T ss_pred             cCCCCCCCCC---CCCCCCCCCCCcCcCCC
Confidence            4999999653   45668999999995433


No 127
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=74.98  E-value=2  Score=33.01  Aligned_cols=27  Identities=26%  Similarity=0.623  Sum_probs=21.2

Q ss_pred             CCCCCCccccccccceeecCCCCceeee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      -||.||.-+. ..+....|++||.....
T Consensus         2 fC~~Cg~~l~-~~~~~~~C~~C~~~~~~   28 (104)
T TIGR01384         2 FCPKCGSLMT-PKNGVYVCPSCGYEKEK   28 (104)
T ss_pred             CCcccCcccc-cCCCeEECcCCCCcccc
Confidence            5999999996 34567999999976544


No 128
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=74.80  E-value=2.1  Score=30.54  Aligned_cols=25  Identities=20%  Similarity=0.444  Sum_probs=17.7

Q ss_pred             CCCCCCccccccccc----------------eeecCCCCce
Q 026283          183 ACPACKREFIGSKSQ----------------IIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt----------------~~~CpnCGe~  207 (240)
                      .|++|+|.+..-.+.                .-.||-||..
T Consensus         3 ~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~w~CP~C~a~   43 (50)
T cd00730           3 ECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGAG   43 (50)
T ss_pred             CCCCCCeEECCCCCCcccCcCCCCCHhHCCCCCCCCCCCCc
Confidence            699999998854321                2389999853


No 129
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=74.72  E-value=3.2  Score=35.01  Aligned_cols=32  Identities=25%  Similarity=0.571  Sum_probs=23.6

Q ss_pred             CCCCCCCccc----------ccccc-ceeecCCCCceeeeeCC
Q 026283          182 GACPACKREF----------IGSKS-QIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~eF----------tG~nn-t~~~CpnCGe~l~v~~g  213 (240)
                      ..||-|+.++          ..++. ....||.||+.+....+
T Consensus        78 PgCP~CGn~~~fa~C~CGkl~Ci~g~~~~~CPwCg~~g~~~~~  120 (131)
T PF15616_consen   78 PGCPHCGNQYAFAVCGCGKLFCIDGEGEVTCPWCGNEGSFGAG  120 (131)
T ss_pred             CCCCCCcChhcEEEecCCCEEEeCCCCCEECCCCCCeeeeccc
Confidence            6799999982          33333 35789999998887765


No 130
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=74.52  E-value=1.3  Score=37.50  Aligned_cols=31  Identities=32%  Similarity=0.674  Sum_probs=26.7

Q ss_pred             hcCCCCCCC--ccccccccceeecCCCCceeee
Q 026283          180 IKGACPACK--REFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       180 Ieg~CPvC~--~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      ..+.||.|+  +=|-||=...-.|..||+..--
T Consensus        20 l~grCP~CGeGrLF~gFLK~~p~C~aCG~dyg~   52 (126)
T COG5349          20 LRGRCPRCGEGRLFRGFLKVVPACEACGLDYGF   52 (126)
T ss_pred             hcCCCCCCCCchhhhhhcccCchhhhccccccC
Confidence            468999997  5699999999999999998743


No 131
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=73.71  E-value=2.1  Score=39.85  Aligned_cols=34  Identities=15%  Similarity=0.357  Sum_probs=14.5

Q ss_pred             CCCCCCCcc-ccccccc----eeecCCCCceeeee--CCCc
Q 026283          182 GACPACKRE-FIGSKSQ----IIRCAGCGNIVWQP--EGDF  215 (240)
Q Consensus       182 g~CPvC~~e-FtG~nnt----~~~CpnCGe~l~v~--~g~F  215 (240)
                      ..||.||.+ ..-+.|-    ...||+|+|.-...  +|.+
T Consensus        32 ~yCP~Cg~~~L~~f~NN~PVaDF~C~~C~eeyELKSk~~~l   72 (254)
T PF06044_consen   32 MYCPNCGSKPLSKFENNRPVADFYCPNCNEEYELKSKKKKL   72 (254)
T ss_dssp             ---TTT--SS-EE--------EEE-TTT--EEEEEEEESS-
T ss_pred             CcCCCCCChhHhhccCCCccceeECCCCchHHhhhhhcccc
Confidence            689999998 6666553    46899999975544  4554


No 132
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=73.65  E-value=2.2  Score=29.77  Aligned_cols=24  Identities=25%  Similarity=0.746  Sum_probs=19.0

Q ss_pred             CCCCCCcccccccc---------ceeecCCCCc
Q 026283          183 ACPACKREFIGSKS---------QIIRCAGCGN  206 (240)
Q Consensus       183 ~CPvC~~eFtG~nn---------t~~~CpnCGe  206 (240)
                      -||-||..-+....         ..+.|.+||-
T Consensus         5 PCPFCG~~~~~~~~~~~~~~~~~~~V~C~~Cga   37 (61)
T PF14354_consen    5 PCPFCGSADVLIRQDEGFDYGMYYYVECTDCGA   37 (61)
T ss_pred             CCCCCCCcceEeecccCCCCCCEEEEEcCCCCC
Confidence            49999988777665         4567999998


No 133
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair]
Probab=73.46  E-value=1.4  Score=45.46  Aligned_cols=38  Identities=29%  Similarity=0.620  Sum_probs=30.5

Q ss_pred             cCCCCCCCccccc-cccceeecCC---CCceeeeeCCCcccC
Q 026283          181 KGACPACKREFIG-SKSQIIRCAG---CGNIVWQPEGDFFSR  218 (240)
Q Consensus       181 eg~CPvC~~eFtG-~nnt~~~Cpn---CGe~l~v~~g~F~s~  218 (240)
                      -..||+|+.++.= -....++|+|   |.......=-||.|+
T Consensus       404 P~~CP~C~s~l~r~~~e~~~rC~n~~~C~aq~~e~l~hfvSr  445 (667)
T COG0272         404 PTHCPVCGSELVREEGEVVIRCTNGLNCPAQLKERLIHFVSR  445 (667)
T ss_pred             CCCCCCCCCeeEeccCceeEecCCCCCChHHHhhheeeEecC
Confidence            4579999999985 4467789998   999888888888554


No 134
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=73.18  E-value=2.1  Score=27.97  Aligned_cols=17  Identities=29%  Similarity=0.882  Sum_probs=14.9

Q ss_pred             eeecCCCCceeeeeCCC
Q 026283          198 IIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g~  214 (240)
                      |..|.+|+..|+.|.|-
T Consensus         1 q~~C~~C~t~L~yP~gA   17 (31)
T TIGR01053         1 QVVCGGCRTLLMYPRGA   17 (31)
T ss_pred             CcCcCCCCcEeecCCCC
Confidence            56899999999999884


No 135
>PRK11823 DNA repair protein RadA; Provisional
Probab=73.15  E-value=1.9  Score=41.39  Aligned_cols=27  Identities=26%  Similarity=0.395  Sum_probs=20.0

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      -.|..|||+..-.   .-+||+||+-=+++
T Consensus         8 y~C~~Cg~~~~~~---~g~Cp~C~~w~t~~   34 (446)
T PRK11823          8 YVCQECGAESPKW---LGRCPECGAWNTLV   34 (446)
T ss_pred             EECCcCCCCCccc---CeeCcCCCCcccee
Confidence            4699999987644   56899999754443


No 136
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=73.05  E-value=4.7  Score=28.74  Aligned_cols=25  Identities=20%  Similarity=0.550  Sum_probs=17.0

Q ss_pred             CccccccccceeecCCCCceeeeeC
Q 026283          188 KREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       188 ~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      .|++.|-..+...|++||.+|....
T Consensus        38 ~y~~s~~~~~r~FC~~CGs~l~~~~   62 (92)
T PF04828_consen   38 EYQFSGKGVERYFCPTCGSPLFSED   62 (92)
T ss_dssp             EC--TTSSCEEEEETTT--EEEEEE
T ss_pred             EEEeCCCcCcCcccCCCCCeeeccc
Confidence            3455677888899999999999753


No 137
>PHA00626 hypothetical protein
Probab=72.95  E-value=2.6  Score=31.65  Aligned_cols=27  Identities=30%  Similarity=0.566  Sum_probs=18.2

Q ss_pred             CCCCCCCcccccc-----c-cceeecCCCCcee
Q 026283          182 GACPACKREFIGS-----K-SQIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eFtG~-----n-nt~~~CpnCGe~l  208 (240)
                      +.||.||..=+-.     + .+.-.||.||---
T Consensus         1 m~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~f   33 (59)
T PHA00626          1 MSCPKCGSGNIAKEKTMRGWSDDYVCCDCGYND   33 (59)
T ss_pred             CCCCCCCCceeeeeceecccCcceEcCCCCCee
Confidence            4699999952222     2 4667899998643


No 138
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=72.77  E-value=2.6  Score=40.69  Aligned_cols=31  Identities=23%  Similarity=0.435  Sum_probs=22.2

Q ss_pred             CCCCCCccc--ccc-ccceeecCCCCceeeeeCC
Q 026283          183 ACPACKREF--IGS-KSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       183 ~CPvC~~eF--tG~-nnt~~~CpnCGe~l~v~~g  213 (240)
                      .||.|+.-.  .-+ .+++-+||.||..|.-.+.
T Consensus        12 ~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~~~~   45 (419)
T PRK15103         12 LCPQCDMLVALPRLEHGQKAACPRCGTTLTVRWD   45 (419)
T ss_pred             cCCCCCceeecCCCCCCCeeECCCCCCCCcCCCC
Confidence            499999754  222 3567889999999965443


No 139
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=72.63  E-value=2.9  Score=27.48  Aligned_cols=25  Identities=24%  Similarity=0.493  Sum_probs=20.5

Q ss_pred             CCCCCCccccc-cccceeecCCCCce
Q 026283          183 ACPACKREFIG-SKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG-~nnt~~~CpnCGe~  207 (240)
                      .|++|+.+-.= -++....|++||.+
T Consensus         5 ~C~~C~~~~i~~~~~~~~~C~~Cg~~   30 (33)
T PF08792_consen    5 KCSKCGGNGIVNKEDDYEVCIFCGSS   30 (33)
T ss_pred             EcCCCCCCeEEEecCCeEEcccCCcE
Confidence            58999988766 67778899999975


No 140
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=72.58  E-value=2  Score=33.01  Aligned_cols=17  Identities=29%  Similarity=0.638  Sum_probs=12.0

Q ss_pred             cceeecCCCCceeeeeC
Q 026283          196 SQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       196 nt~~~CpnCGe~l~v~~  212 (240)
                      -....|+.|||.+.-++
T Consensus        29 ~~~~~C~~CGe~~~~~e   45 (127)
T TIGR03830        29 VPGWYCPACGEELLDPE   45 (127)
T ss_pred             eeeeECCCCCCEEEcHH
Confidence            34568999999876543


No 141
>KOG4517 consensus Uncharacterized conserved protein [Function unknown]
Probab=72.27  E-value=1.6  Score=36.54  Aligned_cols=15  Identities=27%  Similarity=0.563  Sum_probs=10.5

Q ss_pred             cccceeecCCCCcee
Q 026283          194 SKSQIIRCAGCGNIV  208 (240)
Q Consensus       194 ~nnt~~~CpnCGe~l  208 (240)
                      +--++-+|||||+.+
T Consensus       102 ~alr~rrc~ncg~~f  116 (117)
T KOG4517|consen  102 FALRKRRCPNCGPTF  116 (117)
T ss_pred             HhhhhccCCCccccc
Confidence            345677888888764


No 142
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=72.24  E-value=2.1  Score=42.52  Aligned_cols=23  Identities=26%  Similarity=0.589  Sum_probs=18.2

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      +.|+.|||...|.   .-.||.||+.
T Consensus       519 ~~C~~CG~~~~~~---~~~CP~CGs~  541 (555)
T cd01675         519 DICNDCGYIGEGE---GFKCPKCGSE  541 (555)
T ss_pred             ccCCCCCCCCcCC---CCCCcCCCCc
Confidence            4999999866544   4899999964


No 143
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=72.07  E-value=2.1  Score=41.42  Aligned_cols=26  Identities=15%  Similarity=0.221  Sum_probs=19.6

Q ss_pred             CCCCCCCccccccccceeecCCCCceeee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      -.|..|||++.-.   .-+||+||+==++
T Consensus         8 y~C~~Cg~~~~~~---~g~Cp~C~~w~t~   33 (454)
T TIGR00416         8 FVCQHCGADSPKW---QGKCPACHAWNTI   33 (454)
T ss_pred             EECCcCCCCCccc---cEECcCCCCcccc
Confidence            4699999997654   5689999974333


No 144
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=71.84  E-value=2.6  Score=26.67  Aligned_cols=15  Identities=33%  Similarity=0.851  Sum_probs=8.4

Q ss_pred             ecCCCCceeeeeCCC
Q 026283          200 RCAGCGNIVWQPEGD  214 (240)
Q Consensus       200 ~CpnCGe~l~v~~g~  214 (240)
                      .||.||..|....|.
T Consensus         1 ~CP~C~s~l~~~~~e   15 (28)
T PF03119_consen    1 TCPVCGSKLVREEGE   15 (28)
T ss_dssp             B-TTT--BEEE-CCT
T ss_pred             CcCCCCCEeEcCCCC
Confidence            589999988877664


No 145
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=71.79  E-value=3.1  Score=27.68  Aligned_cols=10  Identities=30%  Similarity=0.847  Sum_probs=5.3

Q ss_pred             ecCCCCceee
Q 026283          200 RCAGCGNIVW  209 (240)
Q Consensus       200 ~CpnCGe~l~  209 (240)
                      .||+||..|.
T Consensus         4 ~C~~Cg~~l~   13 (47)
T PF13005_consen    4 ACPDCGGELK   13 (47)
T ss_pred             cCCCCCceee
Confidence            4555555554


No 146
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=71.71  E-value=3  Score=30.09  Aligned_cols=32  Identities=31%  Similarity=0.570  Sum_probs=25.1

Q ss_pred             CCCCCCCcccccc-ccceeecCCCCceeeeeCC
Q 026283          182 GACPACKREFIGS-KSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~eFtG~-nnt~~~CpnCGe~l~v~~g  213 (240)
                      -.|--||.+|.=. ....++||.||--+-+..-
T Consensus         7 Y~C~~Cg~~~~~~~~~~~irCp~Cg~rIl~K~R   39 (49)
T COG1996           7 YKCARCGREVELDQETRGIRCPYCGSRILVKER   39 (49)
T ss_pred             EEhhhcCCeeehhhccCceeCCCCCcEEEEecc
Confidence            3588999999633 6778999999988877643


No 147
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=71.28  E-value=1.2  Score=37.62  Aligned_cols=24  Identities=29%  Similarity=0.681  Sum_probs=19.4

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      -+||.||.-|+- + .+..||.|.+.
T Consensus         4 ~nC~~CgklF~~-~-~~~iCp~C~~~   27 (137)
T TIGR03826         4 ANCPKCGRLFVK-T-GRDVCPSCYEE   27 (137)
T ss_pred             ccccccchhhhh-c-CCccCHHHhHH
Confidence            379999999998 4 55669999864


No 148
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=71.23  E-value=1.2  Score=39.01  Aligned_cols=31  Identities=19%  Similarity=0.517  Sum_probs=23.1

Q ss_pred             CCCCCCCcccc--ccccceeecCCCCceeeeeC
Q 026283          182 GACPACKREFI--GSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       182 g~CPvC~~eFt--G~nnt~~~CpnCGe~l~v~~  212 (240)
                      -.||.|...++  --...+..||-||+.|..-+
T Consensus       114 y~C~~~~~r~sfdeA~~~~F~Cp~Cg~~L~~~d  146 (176)
T COG1675         114 YVCPNCHVKYSFDEAMELGFTCPKCGEDLEEYD  146 (176)
T ss_pred             eeCCCCCCcccHHHHHHhCCCCCCCCchhhhcc
Confidence            47999976554  44556689999999997544


No 149
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=71.23  E-value=1.7  Score=40.68  Aligned_cols=31  Identities=35%  Similarity=0.817  Sum_probs=25.2

Q ss_pred             hhcCCCCCCCcccccccc--ceeecCCCCceee
Q 026283          179 VIKGACPACKREFIGSKS--QIIRCAGCGNIVW  209 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nn--t~~~CpnCGe~l~  209 (240)
                      +-|-.||.|++.|+|+-+  ...-|-+||.+|.
T Consensus       153 ~aef~C~~C~h~F~G~~qm~v~sPCy~C~~~v~  185 (278)
T PF15135_consen  153 IAEFHCPKCRHNFRGFAQMGVPSPCYGCGNPVY  185 (278)
T ss_pred             eeeeecccccccchhhhhcCCCCCccCCCCccC
Confidence            557799999999999954  3456999999983


No 150
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional
Probab=70.88  E-value=0.99  Score=46.28  Aligned_cols=37  Identities=22%  Similarity=0.536  Sum_probs=28.7

Q ss_pred             cCCCCCCCccccccccceeecCC---CCceeeeeCCCcccC
Q 026283          181 KGACPACKREFIGSKSQIIRCAG---CGNIVWQPEGDFFSR  218 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~Cpn---CGe~l~v~~g~F~s~  218 (240)
                      -..||+|+.+.+- ++....|+|   |-..+...=-||.|+
T Consensus       423 P~~CP~C~~~l~~-~~~~~~C~n~~~Cpaq~~~~l~hf~sr  462 (689)
T PRK14351        423 PDTCPVCDSAVER-DGPLAFCTGGLACPAQLERSIEHYASR  462 (689)
T ss_pred             CCCCCCCCCEeee-CCceEEcCCCCCCHHHHHHHHHHHhcc
Confidence            4699999999875 567888985   988777666788554


No 151
>TIGR00398 metG methionyl-tRNA synthetase. The methionyl-tRNA synthetase (metG) is a class I amino acyl-tRNA ligase. This model appears to recognize the methionyl-tRNA synthetase of every species, including eukaryotic cytosolic and mitochondrial forms. The UPGMA difference tree calculated after search and alignment according to this model shows an unusual deep split between two families of MetG. One family contains forms from the Archaea, yeast cytosol, spirochetes, and E. coli, among others. The other family includes forms from yeast mitochondrion, Synechocystis sp., Bacillus subtilis, the Mycoplasmas, Aquifex aeolicus, and Helicobacter pylori. The E. coli enzyme is homodimeric, although monomeric forms can be prepared that are fully active. Activity of this enzyme in bacteria includes aminoacylation of fMet-tRNA with Met; subsequent formylation of the Met to fMet is catalyzed by a separate enzyme. Note that the protein from Aquifex aeolicus is split into an alpha (large) and beta (sma
Probab=70.86  E-value=2  Score=41.24  Aligned_cols=26  Identities=31%  Similarity=0.827  Sum_probs=18.0

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCcee
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      -|+|.||.|+++    ..--.+|.+||..+
T Consensus       134 ~v~g~cp~c~~~----~~~g~~ce~cg~~~  159 (530)
T TIGR00398       134 YVEGTCPKCGSE----DARGDHCEVCGRHL  159 (530)
T ss_pred             hhcCCCCCCCCc----ccccchhhhccccC
Confidence            457999999885    12245688888754


No 152
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=70.83  E-value=2.2  Score=28.75  Aligned_cols=17  Identities=18%  Similarity=0.282  Sum_probs=9.8

Q ss_pred             CCCCCCcccccccccee
Q 026283          183 ACPACKREFIGSKSQII  199 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~  199 (240)
                      .||.|++.=.-+.+.|+
T Consensus         2 ~Cp~C~~~~a~~~q~Q~   18 (40)
T smart00440        2 PCPKCGNREATFFQLQT   18 (40)
T ss_pred             cCCCCCCCeEEEEEEcc
Confidence            47777766555554443


No 153
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=70.82  E-value=2.1  Score=47.31  Aligned_cols=26  Identities=27%  Similarity=0.646  Sum_probs=18.1

Q ss_pred             hcCCCCCCCccccccccceeecCCCCceee
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      .+..||.||.+..    ....||+||..+.
T Consensus       678 ~~~fCP~CGs~te----~vy~CPsCGaev~  703 (1337)
T PRK14714        678 YENRCPDCGTHTE----PVYVCPDCGAEVP  703 (1337)
T ss_pred             ccccCcccCCcCC----CceeCccCCCccC
Confidence            4568999998852    3457777777654


No 154
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=70.35  E-value=2  Score=30.24  Aligned_cols=17  Identities=29%  Similarity=0.710  Sum_probs=14.5

Q ss_pred             hhhhhcCCCCCCCcccc
Q 026283          176 NNFVIKGACPACKREFI  192 (240)
Q Consensus       176 kRnLIeg~CPvC~~eFt  192 (240)
                      |.+|-+-.||+|+.+|+
T Consensus         3 K~~lp~K~C~~C~rpf~   19 (42)
T PF10013_consen    3 KSNLPSKICPVCGRPFT   19 (42)
T ss_pred             cccCCCCcCcccCCcch
Confidence            45778889999999997


No 155
>PF11241 DUF3043:  Protein of unknown function (DUF3043);  InterPro: IPR021403  Some members in this family of proteins with unknown function are annotated as membrane proteins. This cannot be confirmed. 
Probab=70.20  E-value=77  Score=27.92  Aligned_cols=55  Identities=25%  Similarity=0.326  Sum_probs=26.5

Q ss_pred             HHHHHHhhhhhhhhHhHHhhhhhhhhhchh----HHHHHHHhhCCC--CchHHHHHHHHHH
Q 026283           92 AVRARELDREFAISVRWRSFRMDFSRNWPR----YRKQLNDFLNTP--LGRSFATIFFLWF  146 (240)
Q Consensus        92 ~e~A~eiD~~fgi~rR~R~f~~D~~r~wP~----yrrql~~F~~T~--lG~wL~tl~~~wl  146 (240)
                      +.+++|--++-.-++|-++.+-|=+-.-|+    -|+-+-|+-|+.  +|.++.-++++-+
T Consensus        29 k~~~R~~~r~~r~~~r~aM~~GDeryLp~RDrGP~Rr~vRD~VDsR~~i~e~fmP~alv~l   89 (170)
T PF11241_consen   29 KKRAREARRERRARQREAMMTGDERYLPPRDRGPVRRYVRDYVDSRRNIGEFFMPVALVLL   89 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcChhhcCCcccccchhhhhhhhhhcccchHHHHHHHHHHHH
Confidence            333333333333445666666664333333    345555665553  6776644444333


No 156
>PRK00133 metG methionyl-tRNA synthetase; Reviewed
Probab=70.05  E-value=2  Score=43.11  Aligned_cols=25  Identities=40%  Similarity=0.930  Sum_probs=17.5

Q ss_pred             hhcCCCCCCCcc-ccccccceeecCCCCcee
Q 026283          179 VIKGACPACKRE-FIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       179 LIeg~CPvC~~e-FtG~nnt~~~CpnCGe~l  208 (240)
                      -|+|.||.|+++ .-|     .+|-+||..+
T Consensus       137 ~v~g~cp~C~~~d~~g-----~~ce~cg~~~  162 (673)
T PRK00133        137 FVKGTCPKCGAEDQYG-----DNCEVCGATY  162 (673)
T ss_pred             heecccCCCCCcccCC-----chhhhccccC
Confidence            467999999987 222     3577777654


No 157
>PRK08115 ribonucleotide-diphosphate reductase subunit alpha; Validated
Probab=70.00  E-value=2  Score=45.43  Aligned_cols=29  Identities=21%  Similarity=0.611  Sum_probs=21.5

Q ss_pred             cCCCCCCCccccccccceeecCCCCceee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      .+.||+|+..=+---+.--.|+|||-.|+
T Consensus       827 ~~~cp~c~~~~~~~~~~c~~c~~c~~~~~  855 (858)
T PRK08115        827 GNTCPVCREGTVEEIGGCNTCTNCGAQLK  855 (858)
T ss_pred             CCCCCccCCCceeecCCCccccchhhhhc
Confidence            46899999866544445557999998775


No 158
>KOG1247 consensus Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=69.95  E-value=1.5  Score=44.16  Aligned_cols=32  Identities=28%  Similarity=0.661  Sum_probs=25.0

Q ss_pred             HHHhhhhhcCCCCCCCccccccccceeecCCCCcee
Q 026283          173 TVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      ..|-.+.|||.||-|+|.=.    .--||-+||+.|
T Consensus       144 ~fladr~veg~cp~C~yd~A----RGDqcd~cG~l~  175 (567)
T KOG1247|consen  144 TFLADRFVEGKCPFCGYDDA----RGDQCDKCGKLV  175 (567)
T ss_pred             ccccchhhhccCCCCCCccc----cchhhhhhhhhc
Confidence            44567899999999999743    446899999865


No 159
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=69.87  E-value=2.2  Score=43.66  Aligned_cols=25  Identities=28%  Similarity=0.675  Sum_probs=16.9

Q ss_pred             CCCCCCCccccccccceeecCCCCceee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      ..||.||++   ..-..-.||+||..+-
T Consensus        28 ~~Cp~CG~~---~~~~~~fC~~CG~~~~   52 (645)
T PRK14559         28 KPCPQCGTE---VPVDEAHCPNCGAETG   52 (645)
T ss_pred             CcCCCCCCC---CCcccccccccCCccc
Confidence            467777777   3345567888887653


No 160
>PHA00732 hypothetical protein
Probab=69.44  E-value=4  Score=31.18  Aligned_cols=33  Identities=18%  Similarity=0.479  Sum_probs=25.0

Q ss_pred             CCCCCCccccccc---------cceeecCCCCceeeeeCCCc
Q 026283          183 ACPACKREFIGSK---------SQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       183 ~CPvC~~eFtG~n---------nt~~~CpnCGe~l~v~~g~F  215 (240)
                      .|+.|++.|.-..         .+.-.|+.||+.....+-|+
T Consensus         3 ~C~~Cgk~F~s~s~Lk~H~r~~H~~~~C~~CgKsF~~l~~H~   44 (79)
T PHA00732          3 KCPICGFTTVTLFALKQHARRNHTLTKCPVCNKSYRRLNQHF   44 (79)
T ss_pred             cCCCCCCccCCHHHHHHHhhcccCCCccCCCCCEeCChhhhh
Confidence            5999999986411         12237999999999888887


No 161
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=69.06  E-value=2.1  Score=35.79  Aligned_cols=31  Identities=29%  Similarity=0.604  Sum_probs=24.8

Q ss_pred             hhhhcCCCCCCCcccccccccee-----------ecCCCCce
Q 026283          177 NFVIKGACPACKREFIGSKSQII-----------RCAGCGNI  207 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG~nnt~~-----------~CpnCGe~  207 (240)
                      ...|+-.||.||++=--|.--|.           .||+|+--
T Consensus        70 ga~I~~kCpkCghe~m~Y~T~QlRSADEGQTVFYTC~kC~~k  111 (116)
T KOG2907|consen   70 GAVIKHKCPKCGHEEMSYHTLQLRSADEGQTVFYTCPKCKYK  111 (116)
T ss_pred             ccchhccCcccCCchhhhhhhhcccccCCceEEEEcCcccee
Confidence            36789999999999888876665           49999853


No 162
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=68.97  E-value=1.2  Score=32.03  Aligned_cols=27  Identities=30%  Similarity=0.739  Sum_probs=21.6

Q ss_pred             cCCCCCCCcccc------------ccccceeecCCCCce
Q 026283          181 KGACPACKREFI------------GSKSQIIRCAGCGNI  207 (240)
Q Consensus       181 eg~CPvC~~eFt------------G~nnt~~~CpnCGe~  207 (240)
                      +-.|--||.+|+            |+.|...+||.|...
T Consensus         4 ~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR~~   42 (49)
T PF13451_consen    4 TLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCRQA   42 (49)
T ss_pred             eEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHHHH
Confidence            346888998886            888899999999754


No 163
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=68.96  E-value=3  Score=36.14  Aligned_cols=31  Identities=29%  Similarity=0.712  Sum_probs=21.0

Q ss_pred             hhhcCCCCCCCccccc--------cccceeecCCCCcee
Q 026283          178 FVIKGACPACKREFIG--------SKSQIIRCAGCGNIV  208 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG--------~nnt~~~CpnCGe~l  208 (240)
                      ++-+..|+.|+..+.-        ...+.-.||+||.+|
T Consensus        92 ~~~~~~C~~C~~~~~~~~~~~~~~~~~~~p~C~~Cgg~l  130 (206)
T cd01410          92 NMFIEVCKSCGPEYVRDDVVETRGDKETGRRCHACGGIL  130 (206)
T ss_pred             CcCcccCCCCCCccchHHHHHHhhcCCCCCcCCCCcCcc
Confidence            3445789999987641        123457799998764


No 164
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=68.92  E-value=3.5  Score=39.57  Aligned_cols=29  Identities=21%  Similarity=0.423  Sum_probs=21.7

Q ss_pred             CCCCCCcccc---ccccceeecCCCCceeeee
Q 026283          183 ACPACKREFI---GSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       183 ~CPvC~~eFt---G~nnt~~~CpnCGe~l~v~  211 (240)
                      .||.|+.-..   --.+++-+||.||..|.-.
T Consensus        15 ~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~~   46 (403)
T TIGR00155        15 LCSQCDMLVALPRIESGQKAACPRCGTTLTVG   46 (403)
T ss_pred             eCCCCCCcccccCCCCCCeeECCCCCCCCcCC
Confidence            5999996552   2256778999999999543


No 165
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=68.85  E-value=2.3  Score=42.92  Aligned_cols=36  Identities=25%  Similarity=0.561  Sum_probs=25.9

Q ss_pred             HHHhhhhhcCCCCCCCccccccccceeecCCCCceeeeeC
Q 026283          173 TVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      -++-..-|+|.||-|+++=.+-    -||-|||..+.-.+
T Consensus       134 ~fl~dr~v~g~cp~cg~~~arG----D~Ce~Cg~~~~P~~  169 (558)
T COG0143         134 RFLPDRYVEGTCPKCGGEDARG----DQCENCGRTLDPTE  169 (558)
T ss_pred             ccccchheeccCCCcCccccCc----chhhhccCcCCchh
Confidence            3455667899999999886654    46888887665443


No 166
>PRK12366 replication factor A; Reviewed
Probab=68.58  E-value=2.3  Score=42.91  Aligned_cols=31  Identities=23%  Similarity=0.550  Sum_probs=25.4

Q ss_pred             hhhhhcCCCCCCCccccccccceeecCCCCce
Q 026283          176 NNFVIKGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       176 kRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      ..+....+||.|++-.+- ....-+||.||+.
T Consensus       527 ~~~~~y~aCp~CnkKv~~-~~g~~~C~~c~~~  557 (637)
T PRK12366        527 KQKIILYLCPNCRKRVEE-VDGEYICEFCGEV  557 (637)
T ss_pred             CCCEEEecccccCeEeEc-CCCcEECCCCCCC
Confidence            567788999999998874 4556789999986


No 167
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=68.51  E-value=3.3  Score=33.31  Aligned_cols=25  Identities=36%  Similarity=0.864  Sum_probs=15.6

Q ss_pred             CCCCCCccccc----cccceeecCCCCce
Q 026283          183 ACPACKREFIG----SKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG----~nnt~~~CpnCGe~  207 (240)
                      .||.|+..-+-    =+-....||+||.-
T Consensus        23 ~CP~Cge~~v~v~~~k~~~h~~C~~CG~y   51 (99)
T PRK14892         23 ECPRCGKVSISVKIKKNIAIITCGNCGLY   51 (99)
T ss_pred             ECCCCCCeEeeeecCCCcceEECCCCCCc
Confidence            59999842221    12347789999864


No 168
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=68.49  E-value=2.2  Score=40.83  Aligned_cols=33  Identities=24%  Similarity=0.664  Sum_probs=16.3

Q ss_pred             CCCCCCccccccccce-eecCCCCceeeeeCCCc
Q 026283          183 ACPACKREFIGSKSQI-IRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~-~~CpnCGe~l~v~~g~F  215 (240)
                      .|+.|++..|.|.--. ..|++||+.-|-..|-+
T Consensus       287 kC~~C~~Rt~sl~r~P~~~C~~Cg~~~wer~~M~  320 (344)
T PF09332_consen  287 KCKDCGNRTISLERLPKKHCSNCGSSKWERTGML  320 (344)
T ss_dssp             E-T-TS-EEEESSSS--S--TTT-S---EEE---
T ss_pred             ECCCCCCeeeecccCCCCCCCcCCcCceeehhhh
Confidence            6999999988875433 68999999999888876


No 169
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=68.31  E-value=2.7  Score=36.62  Aligned_cols=33  Identities=24%  Similarity=0.597  Sum_probs=23.4

Q ss_pred             hhhhcCCCCCCCcccccc------ccceeecCCCCceee
Q 026283          177 NFVIKGACPACKREFIGS------KSQIIRCAGCGNIVW  209 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG~------nnt~~~CpnCGe~l~  209 (240)
                      -++-+..|..|+..+.--      ....-.||+||.++.
T Consensus       109 G~l~~~~C~~C~~~~~~~~~~~~~~~~~p~C~~Cgg~lr  147 (222)
T cd01413         109 GTLQTAYCVNCGSKYDLEEVKYAKKHEVPRCPKCGGIIR  147 (222)
T ss_pred             CCcCcceECCCCCCcchhHHHHhccCCCCcCCCCCCccC
Confidence            345567899999877522      345678999998764


No 170
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=68.20  E-value=4  Score=29.70  Aligned_cols=26  Identities=23%  Similarity=0.528  Sum_probs=19.5

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeeeeCCCc
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~F  215 (240)
                      ..+||+||++.+|=..-         .|-|+++.|
T Consensus        13 Y~~Cp~CGN~~vGngEG---------~liV~edtf   38 (49)
T PF12677_consen   13 YCKCPKCGNDKVGNGEG---------TLIVEEDTF   38 (49)
T ss_pred             hccCcccCCcEeecCcc---------eEEEeccce
Confidence            57899999998884433         357888888


No 171
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=68.19  E-value=2.4  Score=38.16  Aligned_cols=27  Identities=22%  Similarity=0.524  Sum_probs=18.6

Q ss_pred             hcCCCCCCCcccccc------------ccceeecCCCCc
Q 026283          180 IKGACPACKREFIGS------------KSQIIRCAGCGN  206 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~------------nnt~~~CpnCGe  206 (240)
                      -...||||+..+.-.            --+...|-+||-
T Consensus        13 ~~~~CPvCg~~l~~~~~~~~IPyFG~V~i~t~~C~~CgY   51 (201)
T COG1779          13 TRIDCPVCGGTLKAHMYLYDIPYFGEVLISTGVCERCGY   51 (201)
T ss_pred             eeecCCcccceeeEEEeeecCCccceEEEEEEEccccCC
Confidence            356899999866432            124568999984


No 172
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=67.91  E-value=3.5  Score=29.70  Aligned_cols=18  Identities=39%  Similarity=0.951  Sum_probs=12.9

Q ss_pred             CCCCCccccccccceeecCCCC
Q 026283          184 CPACKREFIGSKSQIIRCAGCG  205 (240)
Q Consensus       184 CPvC~~eFtG~nnt~~~CpnCG  205 (240)
                      ||.||.    +.-.-..||+||
T Consensus        29 C~~cG~----~~~~H~vc~~cG   46 (55)
T TIGR01031        29 CPNCGE----FKLPHRVCPSCG   46 (55)
T ss_pred             CCCCCC----cccCeeECCccC
Confidence            777775    556667777777


No 173
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=67.74  E-value=2.1  Score=36.35  Aligned_cols=26  Identities=27%  Similarity=0.643  Sum_probs=11.9

Q ss_pred             cCCCCCCCcccc-c--------ccc---ceeecCCCCc
Q 026283          181 KGACPACKREFI-G--------SKS---QIIRCAGCGN  206 (240)
Q Consensus       181 eg~CPvC~~eFt-G--------~nn---t~~~CpnCGe  206 (240)
                      |-.||+|+.+-+ =        |+.   ....|++||-
T Consensus         1 ~s~Cp~C~~~~~~~~~~~~IP~F~evii~sf~C~~CGy   38 (161)
T PF03367_consen    1 ESLCPNCGENGTTRILLTDIPYFKEVIIMSFECEHCGY   38 (161)
T ss_dssp             -EE-TTTSSCCEEEEEEEEETTTEEEEEEEEE-TTT--
T ss_pred             CCcCCCCCCCcEEEEEEEcCCCCceEEEEEeECCCCCC
Confidence            346999998631 1        111   2247999984


No 174
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=67.61  E-value=3  Score=29.82  Aligned_cols=20  Identities=35%  Similarity=0.848  Sum_probs=14.5

Q ss_pred             CCCCCCCccccccccceeecCCCC
Q 026283          182 GACPACKREFIGSKSQIIRCAGCG  205 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCG  205 (240)
                      ..||.||.    +.-.-..||+||
T Consensus        27 ~~c~~cg~----~~~~H~vc~~cG   46 (56)
T PF01783_consen   27 VKCPNCGE----PKLPHRVCPSCG   46 (56)
T ss_dssp             EESSSSSS----EESTTSBCTTTB
T ss_pred             eeeccCCC----EecccEeeCCCC
Confidence            56888884    456667788887


No 175
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=67.56  E-value=2.3  Score=39.65  Aligned_cols=12  Identities=33%  Similarity=0.916  Sum_probs=9.3

Q ss_pred             cCCCCCCCcccc
Q 026283          181 KGACPACKREFI  192 (240)
Q Consensus       181 eg~CPvC~~eFt  192 (240)
                      +-.||||+.-|.
T Consensus        19 ~ieCPvC~tkFk   30 (267)
T COG1655          19 TIECPVCNTKFK   30 (267)
T ss_pred             eeccCcccchhh
Confidence            457999998763


No 176
>smart00532 LIGANc Ligase N family.
Probab=67.54  E-value=1.7  Score=42.29  Aligned_cols=38  Identities=26%  Similarity=0.541  Sum_probs=26.5

Q ss_pred             hcCCCCCCCcccccc-ccceeecCC--CCceeeeeCCCccc
Q 026283          180 IKGACPACKREFIGS-KSQIIRCAG--CGNIVWQPEGDFFS  217 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~-nnt~~~Cpn--CGe~l~v~~g~F~s  217 (240)
                      .-..||+|+.+++=. +....+|+|  |-..+...=-||.|
T Consensus       398 ~P~~CP~C~s~l~~~~~~~~~~C~n~~C~aq~~~~l~hf~s  438 (441)
T smart00532      398 MPTHCPSCGSELVREEGEVDIRCPNPLCPAQLIERIIHFAS  438 (441)
T ss_pred             CCCCCCCCCCEeEecCCceEEEeCCCCCHHHHHHHHHhhhc
Confidence            457999999998633 335677986  87776655567644


No 177
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=67.42  E-value=3.2  Score=39.36  Aligned_cols=18  Identities=11%  Similarity=0.239  Sum_probs=13.0

Q ss_pred             ccceeecCCCCceeeeeC
Q 026283          195 KSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       195 nnt~~~CpnCGe~l~v~~  212 (240)
                      ......||.|+++|.-.+
T Consensus        40 ~~~~~~CP~C~~~lrk~~   57 (309)
T TIGR00570        40 VRGSGSCPECDTPLRKNN   57 (309)
T ss_pred             cCCCCCCCCCCCccchhh
Confidence            344568999999887653


No 178
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=67.33  E-value=2.9  Score=33.45  Aligned_cols=31  Identities=35%  Similarity=0.834  Sum_probs=22.6

Q ss_pred             CCCCCCcccccc---ccceeecCCCCceeeeeCCC
Q 026283          183 ACPACKREFIGS---KSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       183 ~CPvC~~eFtG~---nnt~~~CpnCGe~l~v~~g~  214 (240)
                      -||+|+-+.+-.   +--.-+||.|+. ||...|.
T Consensus         3 lCP~C~v~l~~~~rs~vEiD~CPrCrG-VWLDrGE   36 (88)
T COG3809           3 LCPICGVELVMSVRSGVEIDYCPRCRG-VWLDRGE   36 (88)
T ss_pred             ccCcCCceeeeeeecCceeeeCCcccc-Eeecchh
Confidence            599999888654   334568999986 4766664


No 179
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=67.08  E-value=2.1  Score=28.58  Aligned_cols=12  Identities=25%  Similarity=0.459  Sum_probs=4.5

Q ss_pred             CCCCCccccccc
Q 026283          184 CPACKREFIGSK  195 (240)
Q Consensus       184 CPvC~~eFtG~n  195 (240)
                      ||.|+.+=.-+.
T Consensus         3 Cp~Cg~~~a~~~   14 (39)
T PF01096_consen    3 CPKCGHNEAVFF   14 (39)
T ss_dssp             -SSS-SSEEEEE
T ss_pred             CcCCCCCeEEEE
Confidence            555554444333


No 180
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=66.96  E-value=3.5  Score=33.96  Aligned_cols=16  Identities=31%  Similarity=0.879  Sum_probs=14.4

Q ss_pred             eecCCCCceeeeeCCC
Q 026283          199 IRCAGCGNIVWQPEGD  214 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~  214 (240)
                      ..||.||+.|.|+.|.
T Consensus         2 ~FCP~Cgn~Live~g~   17 (105)
T KOG2906|consen    2 LFCPTCGNMLIVESGE   17 (105)
T ss_pred             cccCCCCCEEEEecCC
Confidence            4699999999999986


No 181
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=66.90  E-value=3.1  Score=34.21  Aligned_cols=31  Identities=23%  Similarity=0.421  Sum_probs=23.6

Q ss_pred             CCCCCCCccccc-------cccceeecCCCCceeeeeC
Q 026283          182 GACPACKREFIG-------SKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       182 g~CPvC~~eFtG-------~nnt~~~CpnCGe~l~v~~  212 (240)
                      -+||.|+.+-+-       .+--...|-|||-.-..+-
T Consensus        23 FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e~ev   60 (104)
T COG4888          23 FTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSFECEV   60 (104)
T ss_pred             EecCccCCeeeeEEEEEecCceeEEEcccCcceEEEec
Confidence            479999999876       4555678999997655443


No 182
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=66.76  E-value=3  Score=37.06  Aligned_cols=32  Identities=25%  Similarity=0.584  Sum_probs=22.2

Q ss_pred             hhhcCCCCCCCcccccc-------ccceeecCCCCceee
Q 026283          178 FVIKGACPACKREFIGS-------KSQIIRCAGCGNIVW  209 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~-------nnt~~~CpnCGe~l~  209 (240)
                      ++-+.+|..|++.+.--       ..+.-.||.||.++.
T Consensus       116 ~~~~~~C~~C~~~~~~~~~~~~~~~~~~p~Cp~Cgg~lr  154 (244)
T PRK14138        116 NVEEYYCVRCGKRYTVEDVIEKLEKSDVPRCDDCSGLIR  154 (244)
T ss_pred             CcCeeEECCCCCcccHHHHHHHHhcCCCCCCCCCCCeEC
Confidence            44456799999887631       224568999997654


No 183
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=66.69  E-value=3.4  Score=35.14  Aligned_cols=29  Identities=31%  Similarity=0.858  Sum_probs=23.5

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCce
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      +|...||.|+...+=..-+...||+||..
T Consensus       147 vv~a~~~~~g~~~~~~~~~~~~c~~~~~~  175 (189)
T PRK09521        147 VIYAMCSRCRTPLVKKGENELKCPNCGNI  175 (189)
T ss_pred             EEEEEccccCCceEECCCCEEECCCCCCE
Confidence            45668999999988777577999999954


No 184
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=66.58  E-value=3.6  Score=40.82  Aligned_cols=30  Identities=23%  Similarity=0.537  Sum_probs=21.9

Q ss_pred             cCCCCCCCcccc----cc--------ccceeecCCCCceeee
Q 026283          181 KGACPACKREFI----GS--------KSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       181 eg~CPvC~~eFt----G~--------nnt~~~CpnCGe~l~v  210 (240)
                      .-.||.|+.++.    ++        .....+||.||..+.-
T Consensus       200 ~vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~Cg~~i~e  241 (557)
T PF05876_consen  200 YVPCPHCGEEQVLEWENLKWDKGEAPETARYVCPHCGCEIEE  241 (557)
T ss_pred             EccCCCCCCCccccccceeecCCCCccceEEECCCCcCCCCH
Confidence            347999998775    22        2356799999998764


No 185
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=66.55  E-value=2.8  Score=27.61  Aligned_cols=16  Identities=31%  Similarity=0.821  Sum_probs=13.5

Q ss_pred             eecCCCCceeeeeCCC
Q 026283          199 IRCAGCGNIVWQPEGD  214 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~  214 (240)
                      ..||.||+.|..+++.
T Consensus         2 ~FCp~C~nlL~p~~~~   17 (35)
T PF02150_consen    2 RFCPECGNLLYPKEDK   17 (35)
T ss_dssp             -BETTTTSBEEEEEET
T ss_pred             eeCCCCCccceEcCCC
Confidence            4699999999998875


No 186
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated
Probab=66.12  E-value=4.6  Score=42.29  Aligned_cols=16  Identities=31%  Similarity=0.661  Sum_probs=14.1

Q ss_pred             ecCCCCceeeeeCCCc
Q 026283          200 RCAGCGNIVWQPEGDF  215 (240)
Q Consensus       200 ~CpnCGe~l~v~~g~F  215 (240)
                      .||.||..+....|+|
T Consensus       647 ~CP~Cg~~m~lK~gr~  662 (860)
T PRK06319        647 PCPLCGGEMKVRHGRF  662 (860)
T ss_pred             cCccCCCeeEEecCCC
Confidence            7999999999888876


No 187
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=65.88  E-value=4.2  Score=36.59  Aligned_cols=28  Identities=14%  Similarity=0.344  Sum_probs=21.4

Q ss_pred             cCCCCCCCccccc-cccceeecCCCCcee
Q 026283          181 KGACPACKREFIG-SKSQIIRCAGCGNIV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG-~nnt~~~CpnCGe~l  208 (240)
                      ..-||.||.+..- -....-+|++||...
T Consensus        99 ~~fC~~CG~~~~~~~~~~~~~C~~c~~~~  127 (256)
T PRK00241         99 HRFCGYCGHPMHPSKTEWAMLCPHCRERY  127 (256)
T ss_pred             CccccccCCCCeecCCceeEECCCCCCEE
Confidence            6789999998753 345667899999654


No 188
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated
Probab=65.86  E-value=1.7  Score=44.30  Aligned_cols=40  Identities=28%  Similarity=0.642  Sum_probs=28.8

Q ss_pred             hcCCCCCCCccccc-cccceeecCC---CCceeeeeCCCcccCC
Q 026283          180 IKGACPACKREFIG-SKSQIIRCAG---CGNIVWQPEGDFFSRN  219 (240)
Q Consensus       180 Ieg~CPvC~~eFtG-~nnt~~~Cpn---CGe~l~v~~g~F~s~~  219 (240)
                      .-..||+|+.+.+= -++...+|+|   |-..+...=-||.|+.
T Consensus       403 ~P~~CP~Cgs~l~~~~~~~~~~C~n~~~C~aq~~~~l~hf~sr~  446 (665)
T PRK07956        403 MPTHCPVCGSELVRVEGEAVLRCTNGLSCPAQLKERLIHFVSRN  446 (665)
T ss_pred             CCCCCCCCCCEeEecCCCeEEECCCCCCCHHHHHHHHHHhhccc
Confidence            44789999998863 2346788985   9887776667885543


No 189
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=65.68  E-value=2.9  Score=35.83  Aligned_cols=27  Identities=30%  Similarity=0.754  Sum_probs=14.2

Q ss_pred             CCCCCCCccc--cccc--------cceeecCCCCcee
Q 026283          182 GACPACKREF--IGSK--------SQIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eF--tG~n--------nt~~~CpnCGe~l  208 (240)
                      -.||.|+.+|  .|+.        ..-..||+|+..+
T Consensus        19 ~~C~~C~~~~~f~g~~~~~~~~~~~~~~~C~~C~~~~   55 (188)
T PF08996_consen   19 LTCPSCGTEFEFPGVFEEDGDDVSPSGLQCPNCSTPL   55 (188)
T ss_dssp             EE-TTT--EEEE-SSS--SSEEEETTEEEETTT--B-
T ss_pred             eECCCCCCCccccccccCCccccccCcCcCCCCCCcC
Confidence            4699999876  5553        3468899999854


No 190
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only]
Probab=65.29  E-value=2  Score=37.96  Aligned_cols=27  Identities=22%  Similarity=0.509  Sum_probs=24.5

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      +.|+.|+..+.=+.+   .|+.||.++...
T Consensus        25 ~~C~~C~~~~~~~~~---~C~~C~~~l~~~   51 (225)
T COG1040          25 GLCSGCQADLPLIGN---LCPLCGLPLSSH   51 (225)
T ss_pred             CcChhhhhchhHHHh---hhHhhhChhccc
Confidence            599999999988877   999999999887


No 191
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=64.88  E-value=3.7  Score=29.60  Aligned_cols=16  Identities=25%  Similarity=0.439  Sum_probs=12.9

Q ss_pred             eecCCCCceeeeeCCC
Q 026283          199 IRCAGCGNIVWQPEGD  214 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~  214 (240)
                      ++||.|||.+.+.=..
T Consensus         1 i~CPyCge~~~~~iD~   16 (52)
T PF14255_consen    1 IQCPYCGEPIEILIDP   16 (52)
T ss_pred             CCCCCCCCeeEEEEec
Confidence            4799999999886554


No 192
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=64.72  E-value=4.1  Score=35.07  Aligned_cols=33  Identities=18%  Similarity=0.531  Sum_probs=23.1

Q ss_pred             hhhhcCCCCCCCcccccc----ccceeecCCCCceee
Q 026283          177 NFVIKGACPACKREFIGS----KSQIIRCAGCGNIVW  209 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG~----nnt~~~CpnCGe~l~  209 (240)
                      -++-+.+|..|++++.--    ....-.||.||..+.
T Consensus       105 G~~~~~~C~~C~~~~~~~~~~~~~~~p~C~~Cgg~lr  141 (224)
T cd01412         105 GSLFRVRCSSCGYVGENNEEIPEEELPRCPKCGGLLR  141 (224)
T ss_pred             CCcCccccCCCCCCCCcchhhhccCCCCCCCCCCccC
Confidence            345567899999987642    233468999998654


No 193
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=64.44  E-value=3.4  Score=32.22  Aligned_cols=24  Identities=29%  Similarity=0.438  Sum_probs=18.8

Q ss_pred             ccccccceeecCCCCceeeeeCCC
Q 026283          191 FIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       191 FtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      |.||=...-+|++||+.+...+.+
T Consensus         1 F~g~Lk~~~~C~~CG~d~~~~~ad   24 (86)
T PF06170_consen    1 FRGYLKVAPRCPHCGLDYSHARAD   24 (86)
T ss_pred             CCccccCCCcccccCCccccCCcC
Confidence            567777788899999988777654


No 194
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=63.98  E-value=4.9  Score=29.28  Aligned_cols=19  Identities=37%  Similarity=0.957  Sum_probs=13.3

Q ss_pred             CCCCCCccccccccceeecCCCC
Q 026283          183 ACPACKREFIGSKSQIIRCAGCG  205 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCG  205 (240)
                      .||.||.    +...-..||+||
T Consensus        29 ~C~~CG~----~~~~H~vC~~CG   47 (57)
T PRK12286         29 ECPNCGE----PKLPHRVCPSCG   47 (57)
T ss_pred             ECCCCCC----ccCCeEECCCCC
Confidence            4777775    455677788887


No 195
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=63.66  E-value=3.2  Score=39.95  Aligned_cols=28  Identities=29%  Similarity=0.676  Sum_probs=20.4

Q ss_pred             cCCCCCCCccccccccce---eecCCCCceeee
Q 026283          181 KGACPACKREFIGSKSQI---IRCAGCGNIVWQ  210 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~---~~CpnCGe~l~v  210 (240)
                      .+.|-.|+..+. ...+.   ..|| ||..+++
T Consensus       240 ~~~c~~C~~~~~-~~~~~~~~~~Cp-CG~~i~~  270 (374)
T TIGR00375       240 QTACEACGEPAV-SEDAETACANCP-CGGRIKK  270 (374)
T ss_pred             hhhhcccCCcCC-chhhhhcCCCCC-CCCccee
Confidence            468999988877 33333   7899 9999553


No 196
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=63.55  E-value=4.6  Score=27.02  Aligned_cols=17  Identities=24%  Similarity=0.540  Sum_probs=13.3

Q ss_pred             eecCCCCceeeeeCCCc
Q 026283          199 IRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~F  215 (240)
                      ..||.||..|.+..|.+
T Consensus         2 ~~CP~Cg~~lv~r~~k~   18 (39)
T PF01396_consen    2 EKCPKCGGPLVLRRGKK   18 (39)
T ss_pred             cCCCCCCceeEEEECCC
Confidence            46889998888887764


No 197
>PRK04011 peptide chain release factor 1; Provisional
Probab=63.48  E-value=3.6  Score=39.50  Aligned_cols=33  Identities=24%  Similarity=0.417  Sum_probs=23.6

Q ss_pred             hcCCCCCCCcccccccc-----ceeecCCCCceeeeeC
Q 026283          180 IKGACPACKREFIGSKS-----QIIRCAGCGNIVWQPE  212 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nn-----t~~~CpnCGe~l~v~~  212 (240)
                      ++-.||.|+++.+-+-.     ....||+||..+.+..
T Consensus       327 ~~~~c~~c~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~  364 (411)
T PRK04011        327 VTYKCPNCGYEEEKTVKRREELPEKTCPKCGSELEIVE  364 (411)
T ss_pred             EEEEcCCCCcceeeecccccccccccCcccCcccccch
Confidence            34569999998765333     3358999999876643


No 198
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=63.44  E-value=5.5  Score=26.47  Aligned_cols=14  Identities=36%  Similarity=0.776  Sum_probs=9.6

Q ss_pred             cceeecCCCCceee
Q 026283          196 SQIIRCAGCGNIVW  209 (240)
Q Consensus       196 nt~~~CpnCGe~l~  209 (240)
                      +..+.||||+.+|.
T Consensus         2 ~~~~~C~nC~R~v~   15 (33)
T PF08209_consen    2 SPYVECPNCGRPVA   15 (33)
T ss_dssp             S-EEE-TTTSSEEE
T ss_pred             CCeEECCCCcCCcc
Confidence            46688999999765


No 199
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=63.33  E-value=4.6  Score=35.42  Aligned_cols=24  Identities=17%  Similarity=0.462  Sum_probs=18.4

Q ss_pred             CCCCCCccccccccceeecCCCCce
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .||+|+.+++= .+...+|+|+-.-
T Consensus         4 ~CP~C~~~l~~-~~~~~~C~~~h~f   27 (272)
T PRK11088          4 QCPLCHQPLTL-EENSWICPQNHQF   27 (272)
T ss_pred             cCCCCCcchhc-CCCEEEcCCCCCC
Confidence            69999999853 5566899997544


No 200
>PRK04023 DNA polymerase II large subunit; Validated
Probab=63.17  E-value=4.1  Score=44.30  Aligned_cols=27  Identities=30%  Similarity=0.672  Sum_probs=20.3

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCceee
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      ...-.||.||.+    ..+..+||.||..+.
T Consensus       636 t~~frCP~CG~~----Te~i~fCP~CG~~~~  662 (1121)
T PRK04023        636 TFYRRCPFCGTH----TEPVYRCPRCGIEVE  662 (1121)
T ss_pred             CCcccCCCCCCC----CCcceeCccccCcCC
Confidence            367899999988    456678888876543


No 201
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=62.84  E-value=3.8  Score=39.99  Aligned_cols=25  Identities=20%  Similarity=0.458  Sum_probs=23.0

Q ss_pred             CCCCCCCccccccccceeecCCCCc
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      -.|+.|+....++......||.||.
T Consensus       241 ~~c~~cg~~~~~~~~~~~~c~~Cg~  265 (380)
T COG1867         241 YHCSRCGEIVGSFREVDEKCPHCGG  265 (380)
T ss_pred             EEcccccceecccccccccCCcccc
Confidence            5799999999999999999999994


No 202
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=62.59  E-value=4.1  Score=33.21  Aligned_cols=33  Identities=27%  Similarity=0.611  Sum_probs=23.3

Q ss_pred             eeecCCCCceeeeeCCCcccCCCCCCCCCCCCCCeee
Q 026283          198 IIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIID  234 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtID  234 (240)
                      -+.||.||+   -+...| .-.|-+.-.|+.+|..++
T Consensus         3 LI~CP~Cg~---R~e~EF-t~~G~A~i~RP~d~a~~s   35 (97)
T COG4311           3 LIPCPYCGE---RPEEEF-TYAGDAHIARPADPADAS   35 (97)
T ss_pred             eecCCCCCC---Cchhhe-eecccccccCCCCcccCC
Confidence            478999999   677777 656656666776665544


No 203
>PF14353 CpXC:  CpXC protein
Probab=62.56  E-value=4.3  Score=32.13  Aligned_cols=14  Identities=29%  Similarity=0.496  Sum_probs=11.1

Q ss_pred             eeecCCCCceeeee
Q 026283          198 IIRCAGCGNIVWQP  211 (240)
Q Consensus       198 ~~~CpnCGe~l~v~  211 (240)
                      +++||+||+...++
T Consensus         1 ~itCP~C~~~~~~~   14 (128)
T PF14353_consen    1 EITCPHCGHEFEFE   14 (128)
T ss_pred             CcCCCCCCCeeEEE
Confidence            47899999986654


No 204
>PRK07217 replication factor A; Reviewed
Probab=62.50  E-value=3.9  Score=38.85  Aligned_cols=21  Identities=38%  Similarity=0.871  Sum_probs=16.9

Q ss_pred             CCCCC--CCccccccccceeecCCCCce
Q 026283          182 GACPA--CKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPv--C~~eFtG~nnt~~~CpnCGe~  207 (240)
                      -.||.  |++-.     |.-+||.||++
T Consensus       189 ~rCP~~~C~Rvl-----~~g~C~~HG~v  211 (311)
T PRK07217        189 KRCPEEDCTRVL-----QNGRCSEHGKV  211 (311)
T ss_pred             ecCCccccCccc-----cCCCCCCCCCc
Confidence            46999  99988     44689999964


No 205
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=61.94  E-value=3  Score=34.58  Aligned_cols=29  Identities=24%  Similarity=0.704  Sum_probs=21.5

Q ss_pred             cCCCCCCCcccccc-------ccceeecCCCCceee
Q 026283          181 KGACPACKREFIGS-------KSQIIRCAGCGNIVW  209 (240)
Q Consensus       181 eg~CPvC~~eFtG~-------nnt~~~CpnCGe~l~  209 (240)
                      +..|..|++++..-       +...-.||.||..|.
T Consensus       105 ~~~C~~C~~~~~~~~~~~~~~~~~~~~C~~C~~~lr  140 (178)
T PF02146_consen  105 RLRCSKCGKEYDREDIVDSIDEEEPPRCPKCGGLLR  140 (178)
T ss_dssp             EEEETTTSBEEEGHHHHHHHHTTSSCBCTTTSCBEE
T ss_pred             eeeecCCCccccchhhcccccccccccccccCccCC
Confidence            36799999987532       344568999999765


No 206
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=61.73  E-value=5.7  Score=38.88  Aligned_cols=11  Identities=27%  Similarity=0.643  Sum_probs=6.7

Q ss_pred             eecCCCCceee
Q 026283          199 IRCAGCGNIVW  209 (240)
Q Consensus       199 ~~CpnCGe~l~  209 (240)
                      .+||+||..-.
T Consensus       254 ~~Cp~C~s~~l  264 (505)
T TIGR00595       254 KTCPQCGSEDL  264 (505)
T ss_pred             CCCCCCCCCee
Confidence            46777776533


No 207
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=61.50  E-value=3.9  Score=31.13  Aligned_cols=22  Identities=36%  Similarity=0.744  Sum_probs=10.6

Q ss_pred             CCCCCCccccccccceeecCCCCce
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      +|-.|+|=-   +...-+||+||-.
T Consensus         6 AC~~Ck~l~---~~d~e~CP~Cgs~   27 (64)
T COG2093           6 ACKNCKRLT---PEDTEICPVCGST   27 (64)
T ss_pred             HHhhccccC---CCCCccCCCCCCc
Confidence            455555432   2233346666654


No 208
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=61.34  E-value=6.8  Score=29.44  Aligned_cols=33  Identities=27%  Similarity=0.483  Sum_probs=26.4

Q ss_pred             CCCCCCCccccccc-cceeecCCCCceeeeeCCC
Q 026283          182 GACPACKREFIGSK-SQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       182 g~CPvC~~eFtG~n-nt~~~CpnCGe~l~v~~g~  214 (240)
                      -.||+|+....=.. ++...|+.|+..--+.+|-
T Consensus         9 LaCP~~kg~L~~~~~~~~L~c~~~~~aYpI~dGI   42 (60)
T COG2835           9 LACPVCKGPLVYDEEKQELICPRCKLAYPIRDGI   42 (60)
T ss_pred             eeccCcCCcceEeccCCEEEecccCceeecccCc
Confidence            47999998855433 4578999999999998885


No 209
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=61.14  E-value=5.2  Score=42.47  Aligned_cols=31  Identities=26%  Similarity=0.422  Sum_probs=25.3

Q ss_pred             cCCCCCCCcccc-------ccccceeecCCC---Cceeeee
Q 026283          181 KGACPACKREFI-------GSKSQIIRCAGC---GNIVWQP  211 (240)
Q Consensus       181 eg~CPvC~~eFt-------G~nnt~~~CpnC---Ge~l~v~  211 (240)
                      ...||.|+++|.       .||+..--||.|   |+.+.+.
T Consensus       250 ~~~c~~~g~~~~~~~~~~FSfNsp~G~Cp~C~G~G~~~~~d  290 (924)
T TIGR00630       250 HAACPECGFSLPELEPRLFSFNSPYGACPECSGLGIKQEFD  290 (924)
T ss_pred             cccCcccCcccCcCChhhcCCCCCcCCCCCCccceeeeecC
Confidence            467999999988       688889999999   7665443


No 210
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=61.08  E-value=15  Score=26.74  Aligned_cols=19  Identities=21%  Similarity=0.405  Sum_probs=14.5

Q ss_pred             cccccceeecCCCCceeee
Q 026283          192 IGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       192 tG~nnt~~~CpnCGe~l~v  210 (240)
                      .+.++..-.|||||..|-.
T Consensus        52 ~~~kd~~H~Cp~C~~~lg~   70 (73)
T PF10601_consen   52 DSCKDVYHYCPNCGAFLGT   70 (73)
T ss_pred             ccccCceEECCCCCCEeEE
Confidence            4567888889999887754


No 211
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=61.08  E-value=4.1  Score=33.45  Aligned_cols=22  Identities=14%  Similarity=0.344  Sum_probs=16.6

Q ss_pred             CccccccccceeecCCCCceee
Q 026283          188 KREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       188 ~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      +-.|+-+.-..+.||.|||++.
T Consensus        37 ~~~~VeIevG~~~cP~Cge~~~   58 (102)
T PF04475_consen   37 DLDYVEIEVGDTICPKCGEELD   58 (102)
T ss_pred             CCCeEEEecCcccCCCCCCccC
Confidence            4567777778888999998763


No 212
>PRK05580 primosome assembly protein PriA; Validated
Probab=60.46  E-value=6  Score=40.04  Aligned_cols=14  Identities=29%  Similarity=0.634  Sum_probs=8.5

Q ss_pred             eeecCCCCceeeee
Q 026283          198 IIRCAGCGNIVWQP  211 (240)
Q Consensus       198 ~~~CpnCGe~l~v~  211 (240)
                      ..+||+||......
T Consensus       421 ~~~Cp~Cg~~~l~~  434 (679)
T PRK05580        421 PKACPECGSTDLVP  434 (679)
T ss_pred             CCCCCCCcCCeeEE
Confidence            34688887764443


No 213
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=60.41  E-value=9.4  Score=25.38  Aligned_cols=23  Identities=26%  Similarity=0.878  Sum_probs=20.3

Q ss_pred             CCCCCccccccccceeecCCCCcee
Q 026283          184 CPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       184 CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      |++|+.  .+-.+..++|-+|++-.
T Consensus         2 C~vC~~--~~~~~~~i~C~~C~~~~   24 (51)
T PF00628_consen    2 CPVCGQ--SDDDGDMIQCDSCNRWY   24 (51)
T ss_dssp             BTTTTS--SCTTSSEEEBSTTSCEE
T ss_pred             CcCCCC--cCCCCCeEEcCCCChhh
Confidence            899999  88899999999999654


No 214
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=60.29  E-value=4.8  Score=35.26  Aligned_cols=34  Identities=24%  Similarity=0.610  Sum_probs=22.4

Q ss_pred             hhhhhcCCCCCCCccccc--c-ccceeecCCCCceee
Q 026283          176 NNFVIKGACPACKREFIG--S-KSQIIRCAGCGNIVW  209 (240)
Q Consensus       176 kRnLIeg~CPvC~~eFtG--~-nnt~~~CpnCGe~l~  209 (240)
                      .-++-+-.|..|++.+..  + .+..-.||.||.++.
T Consensus       117 HG~~~~~~C~~C~~~~~~~~~~~~~~p~C~~Cgg~lr  153 (242)
T PRK00481        117 HGSLLRARCTKCGQTYDLDEYLKPEPPRCPKCGGILR  153 (242)
T ss_pred             cCCcCceeeCCCCCCcChhhhccCCCCCCCCCCCccC
Confidence            345566789999987642  1 233445999997654


No 215
>PF12861 zf-Apc11:  Anaphase-promoting complex subunit 11 RING-H2 finger
Probab=59.92  E-value=6.1  Score=31.27  Aligned_cols=14  Identities=14%  Similarity=0.081  Sum_probs=8.2

Q ss_pred             ceeecCCCCceeee
Q 026283          197 QIIRCAGCGNIVWQ  210 (240)
Q Consensus       197 t~~~CpnCGe~l~v  210 (240)
                      ++.+||-|..+-+.
T Consensus        70 ~~~~CPmCR~~w~~   83 (85)
T PF12861_consen   70 SKGQCPMCRQPWKF   83 (85)
T ss_pred             CCCCCCCcCCeeee
Confidence            34567777665443


No 216
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]
Probab=59.52  E-value=5.4  Score=44.32  Aligned_cols=33  Identities=30%  Similarity=0.684  Sum_probs=24.8

Q ss_pred             cCCCCCCCcc-c-------cccccceeecCCCCceeeeeCCC
Q 026283          181 KGACPACKRE-F-------IGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       181 eg~CPvC~~e-F-------tG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      .--||.|+|. |       .||.--.--||.||+++ ..+||
T Consensus       914 HY~Cp~Cky~Ef~~d~svgsGfDLpdK~CPkCg~pl-~kDG~  954 (1444)
T COG2176         914 HYLCPECKYSEFIDDGSVGSGFDLPDKDCPKCGTPL-KKDGH  954 (1444)
T ss_pred             cccCCCCceeeeecCCCcCCCCCCCCCCCCcCCCcc-ccCCC
Confidence            3469999983 3       36777788999999995 45665


No 217
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=59.52  E-value=5.6  Score=35.87  Aligned_cols=22  Identities=23%  Similarity=0.575  Sum_probs=10.9

Q ss_pred             CCCCCCcccc----ccccceeecCCCC
Q 026283          183 ACPACKREFI----GSKSQIIRCAGCG  205 (240)
Q Consensus       183 ~CPvC~~eFt----G~nnt~~~CpnCG  205 (240)
                      .||+||.+..    | ..+-..||+|+
T Consensus       247 pC~~Cg~~I~~~~~~-gR~t~~CP~CQ  272 (272)
T TIGR00577       247 PCRRCGTPIEKIKVG-GRGTHFCPQCQ  272 (272)
T ss_pred             CCCCCCCeeEEEEEC-CCCCEECCCCC
Confidence            4666665433    3 13334566663


No 218
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=59.29  E-value=4.6  Score=43.85  Aligned_cols=22  Identities=36%  Similarity=1.026  Sum_probs=17.9

Q ss_pred             CCCCCCCccccccccceeecCCCCcee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      -.||.|+.+     .-..+||.||+..
T Consensus       626 RKCPkCG~y-----Tlk~rCP~CG~~T  647 (1095)
T TIGR00354       626 RKCPQCGKE-----SFWLKCPVCGELT  647 (1095)
T ss_pred             EECCCCCcc-----cccccCCCCCCcc
Confidence            379999987     3467899999885


No 219
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=59.17  E-value=6.7  Score=27.19  Aligned_cols=26  Identities=31%  Similarity=0.666  Sum_probs=17.7

Q ss_pred             CCCCCCCcccc------------ccccceeecCCCCce
Q 026283          182 GACPACKREFI------------GSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFt------------G~nnt~~~CpnCGe~  207 (240)
                      =.||.|+.+|.            -.......||=|.+.
T Consensus         3 f~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~   40 (54)
T PF05605_consen    3 FTCPYCGKGFSESSLVEHCEDEHRSESKNVVCPICSSR   40 (54)
T ss_pred             cCCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCchhh
Confidence            36899988765            223446788888763


No 220
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=59.14  E-value=5.3  Score=34.14  Aligned_cols=8  Identities=38%  Similarity=1.257  Sum_probs=6.1

Q ss_pred             CCCCCCcc
Q 026283          183 ACPACKRE  190 (240)
Q Consensus       183 ~CPvC~~e  190 (240)
                      .||+|+.+
T Consensus         2 ~Cp~C~~~    9 (160)
T smart00709        2 DCPSCGGN    9 (160)
T ss_pred             cCCCCCCC
Confidence            48888866


No 221
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=59.06  E-value=3  Score=38.14  Aligned_cols=36  Identities=25%  Similarity=0.571  Sum_probs=27.0

Q ss_pred             hcCCCCCCCcccc-------ccccceeecCCCCceeeeeCCCc
Q 026283          180 IKGACPACKREFI-------GSKSQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       180 Ieg~CPvC~~eFt-------G~nnt~~~CpnCGe~l~v~~g~F  215 (240)
                      .-..|-.|.....       --++...+||+||-+|--..+++
T Consensus       196 ~g~~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgRILy~~e~~~  238 (239)
T COG1579         196 EGRVCGGCHMKLPSQTLSKVRKKDEIVFCPYCGRILYYDESEE  238 (239)
T ss_pred             cCCcccCCeeeecHHHHHHHhcCCCCccCCccchHHHhhhccc
Confidence            4567888876543       22788999999999998777654


No 222
>PRK08197 threonine synthase; Validated
Probab=58.96  E-value=6.5  Score=36.79  Aligned_cols=31  Identities=16%  Similarity=0.384  Sum_probs=23.4

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeeeeCC
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      .-.|+.|+.++. .......| .||.+|.+.-+
T Consensus         7 ~~~C~~Cg~~~~-~~~~~~~C-~cg~~l~~~~d   37 (394)
T PRK08197          7 HLECSKCGETYD-ADQVHNLC-KCGKPLLVRYD   37 (394)
T ss_pred             EEEECCCCCCCC-CCCcceec-CCCCeeEEEec
Confidence            468999999985 34445679 79999888743


No 223
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=58.95  E-value=5.8  Score=28.82  Aligned_cols=16  Identities=19%  Similarity=0.470  Sum_probs=13.6

Q ss_pred             eeecCCCCceeeeeCC
Q 026283          198 IIRCAGCGNIVWQPEG  213 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g  213 (240)
                      +..||.||+.+.+++.
T Consensus         2 ~~~CP~CG~~iev~~~   17 (54)
T TIGR01206         2 QFECPDCGAEIELENP   17 (54)
T ss_pred             ccCCCCCCCEEecCCC
Confidence            3579999999999875


No 224
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=58.29  E-value=17  Score=28.30  Aligned_cols=42  Identities=21%  Similarity=0.271  Sum_probs=28.4

Q ss_pred             HHHHHHHHhh------hhhc--CCCCCCCcccccccc--------ceeecCCCCceee
Q 026283          168 PLLIGTVANN------FVIK--GACPACKREFIGSKS--------QIIRCAGCGNIVW  209 (240)
Q Consensus       168 p~li~wWlkR------nLIe--g~CPvC~~eFtG~nn--------t~~~CpnCGe~l~  209 (240)
                      .++.|+-.+.      +++.  -.||.|+++..-+.+        +.-+|..|++++.
T Consensus        12 ~~~~R~p~~~~~~~~~~i~~~rS~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~~~I~   69 (92)
T PF06750_consen   12 VLAYRLPRGEELEPSLSIIFPRSHCPHCGHPLSWWDLIPILSYLLLRGRCRYCGAPIP   69 (92)
T ss_pred             HHHHHhHhHhhhccCCCccCCCCcCcCCCCcCcccccchHHHHHHhCCCCcccCCCCC
Confidence            3444554454      5553  689999998766655        5668999998764


No 225
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=57.85  E-value=3.8  Score=35.01  Aligned_cols=24  Identities=21%  Similarity=0.452  Sum_probs=18.9

Q ss_pred             hhhhhc--CCCCCCCcccccccccee
Q 026283          176 NNFVIK--GACPACKREFIGSKSQII  199 (240)
Q Consensus       176 kRnLIe--g~CPvC~~eFtG~nnt~~  199 (240)
                      ..|+|+  -+||.||+.|++|..-..
T Consensus        21 ~~~~~~~~~~c~~c~~~f~~~e~~~~   46 (154)
T PRK00464         21 DGNAIRRRRECLACGKRFTTFERVEL   46 (154)
T ss_pred             CCCceeeeeeccccCCcceEeEeccC
Confidence            356777  899999999999865443


No 226
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=57.82  E-value=2.8  Score=31.74  Aligned_cols=33  Identities=24%  Similarity=0.482  Sum_probs=19.4

Q ss_pred             hcCCCCCCCcccccccc--------ceeecCCCCceeeeeC
Q 026283          180 IKGACPACKREFIGSKS--------QIIRCAGCGNIVWQPE  212 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nn--------t~~~CpnCGe~l~v~~  212 (240)
                      ++=+|.+|+.+-+=.-+        -.+|||+|.+.-.+.+
T Consensus         3 l~FTC~~C~~Rs~~~~sk~aY~~GvViv~C~gC~~~HlIaD   43 (66)
T PF05180_consen    3 LTFTCNKCGTRSAKMFSKQAYHKGVVIVQCPGCKNRHLIAD   43 (66)
T ss_dssp             EEEEETTTTEEEEEEEEHHHHHTSEEEEE-TTS--EEES--
T ss_pred             EEEEcCCCCCccceeeCHHHHhCCeEEEECCCCcceeeehh
Confidence            45579999877653222        3579999999877776


No 227
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=57.82  E-value=6.7  Score=40.92  Aligned_cols=16  Identities=19%  Similarity=0.374  Sum_probs=10.2

Q ss_pred             ceeecCCCCceeeeeC
Q 026283          197 QIIRCAGCGNIVWQPE  212 (240)
Q Consensus       197 t~~~CpnCGe~l~v~~  212 (240)
                      ...+||+||....+.-
T Consensus       474 ~p~~Cp~Cgs~~L~~~  489 (730)
T COG1198         474 IPQSCPECGSEHLRAV  489 (730)
T ss_pred             CCCCCCCCCCCeeEEe
Confidence            3457888887755444


No 228
>PLN02569 threonine synthase
Probab=57.56  E-value=7.5  Score=38.24  Aligned_cols=29  Identities=14%  Similarity=0.309  Sum_probs=23.3

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeeeC
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      -.|+.|+.+| ........| .||.+|.+.-
T Consensus        50 l~C~~Cg~~y-~~~~~~~~C-~cgg~l~~~~   78 (484)
T PLN02569         50 LECPLTGEKY-SLDEVVYRS-KSGGLLDVRH   78 (484)
T ss_pred             cEeCCCCCcC-CCccccccC-CCCCeEEEec
Confidence            4899999997 445556789 6999999884


No 229
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=57.54  E-value=10  Score=25.52  Aligned_cols=29  Identities=28%  Similarity=0.527  Sum_probs=23.7

Q ss_pred             hcCCCCCCCccccccccceeecCCCCcee
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      .-..|-+|+....|+..+..+|..|+..+
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~C~~~~   38 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSWCGLVC   38 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETTTT-EE
T ss_pred             CCCCCcccCcccCCCCCCeEEECCCCChH
Confidence            34579999999999999999999999765


No 230
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=57.54  E-value=6.9  Score=30.37  Aligned_cols=30  Identities=23%  Similarity=0.624  Sum_probs=22.4

Q ss_pred             CCCCCCCccccccccc--eeecCCCCceeeeeCCC
Q 026283          182 GACPACKREFIGSKSQ--IIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt--~~~CpnCGe~l~v~~g~  214 (240)
                      -.||.|+|.-..-+..  ---||-|+   |+-+|.
T Consensus         2 ~~CPCCg~~Tl~~~~~~~ydIC~VC~---WEdD~~   33 (78)
T PF14206_consen    2 YPCPCCGYYTLEERGEGTYDICPVCF---WEDDGV   33 (78)
T ss_pred             ccCCCCCcEEeccCCCcCceECCCCC---cccCCc
Confidence            3699999987765554  77899998   666653


No 231
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=56.87  E-value=4.4  Score=44.30  Aligned_cols=22  Identities=32%  Similarity=0.948  Sum_probs=18.8

Q ss_pred             CCCCCCccccccccceeecCCCCce
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .|--|+++|+..  +. .||+||-.
T Consensus       696 rC~dcg~q~~~~--~~-~cP~Cgs~  717 (1187)
T COG1110         696 RCRDCGEQFVDS--ED-KCPRCGSR  717 (1187)
T ss_pred             HHhhcCceeccc--cc-cCCCCCCc
Confidence            599999999999  22 89999973


No 232
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=56.29  E-value=9.2  Score=30.46  Aligned_cols=34  Identities=21%  Similarity=0.314  Sum_probs=25.8

Q ss_pred             hcCCCCCCCccccccccceeecCCCCceeeeeCC
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      -+-.|.-|+.+|.=+.|+-..|+.|+..|=..=|
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~   86 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCG   86 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEEEETTSE
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCccccCccC
Confidence            3558999999999888999999999987754433


No 233
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated
Probab=56.20  E-value=11  Score=39.29  Aligned_cols=22  Identities=32%  Similarity=0.874  Sum_probs=10.1

Q ss_pred             CCCCCCccccccccceeecCCCC
Q 026283          183 ACPACKREFIGSKSQIIRCAGCG  205 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCG  205 (240)
                      .||.|+.... +..-=..|++||
T Consensus       726 ~Cp~Cg~~l~-~~~GC~~C~~CG  747 (752)
T PRK08665        726 ACPECGSILE-HEEGCVVCHSCG  747 (752)
T ss_pred             CCCCCCcccE-ECCCCCcCCCCC
Confidence            4666664322 112223566666


No 234
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=56.03  E-value=6.2  Score=34.49  Aligned_cols=32  Identities=16%  Similarity=0.304  Sum_probs=21.0

Q ss_pred             hhhcCCCCCCCccccccc-cceeecCCCCceee
Q 026283          178 FVIKGACPACKREFIGSK-SQIIRCAGCGNIVW  209 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~n-nt~~~CpnCGe~l~  209 (240)
                      ++-+..|..|+.++.--. ...-.||+||.+|.
T Consensus       115 ~~~~~~C~~C~~~~~~~~~~~~p~C~~Cgg~lr  147 (225)
T cd01411         115 SLYRIYCTVCGKTVDWEEYLKSPYHAKCGGVIR  147 (225)
T ss_pred             CcCeeEeCCCCCccchhhcCCCCCCCCCCCEeC
Confidence            344578999987764211 23467999998764


No 235
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=55.88  E-value=4.9  Score=30.42  Aligned_cols=22  Identities=32%  Similarity=0.490  Sum_probs=15.6

Q ss_pred             cCCCCCCCccccccccceeecCCCCce
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      +-+|..|++=-     ...+||+||-.
T Consensus         5 ~~AC~~C~~i~-----~~~~Cp~Cgs~   26 (64)
T PRK06393          5 YRACKKCKRLT-----PEKTCPVHGDE   26 (64)
T ss_pred             hhhHhhCCccc-----CCCcCCCCCCC
Confidence            45788888755     23389999874


No 236
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=55.61  E-value=7.6  Score=36.42  Aligned_cols=32  Identities=16%  Similarity=0.313  Sum_probs=23.5

Q ss_pred             HHHhhhhhcCCCCCCCccccccc-cceeecCCCCce
Q 026283          173 TVANNFVIKGACPACKREFIGSK-SQIIRCAGCGNI  207 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~n-nt~~~CpnCGe~  207 (240)
                      -|.+.+   --||.||.+-.... ....+||+||+.
T Consensus       106 ~w~~~~---RFCg~CG~~~~~~~~g~~~~C~~cg~~  138 (279)
T COG2816         106 EWYRSH---RFCGRCGTKTYPREGGWARVCPKCGHE  138 (279)
T ss_pred             HHHhhC---cCCCCCCCcCccccCceeeeCCCCCCc
Confidence            455444   46999998876554 467899999985


No 237
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=55.37  E-value=5.6  Score=35.82  Aligned_cols=10  Identities=40%  Similarity=1.198  Sum_probs=4.8

Q ss_pred             cCCCCCCCcc
Q 026283          181 KGACPACKRE  190 (240)
Q Consensus       181 eg~CPvC~~e  190 (240)
                      .+.|||||..
T Consensus       172 ~g~CPvCGs~  181 (290)
T PF04216_consen  172 RGYCPVCGSP  181 (290)
T ss_dssp             -SS-TTT---
T ss_pred             CCcCCCCCCc
Confidence            4899999975


No 238
>PRK07561 DNA topoisomerase I subunit omega; Validated
Probab=54.96  E-value=9.6  Score=39.88  Aligned_cols=16  Identities=25%  Similarity=0.490  Sum_probs=13.9

Q ss_pred             ecCCCCceeeeeCCCc
Q 026283          200 RCAGCGNIVWQPEGDF  215 (240)
Q Consensus       200 ~CpnCGe~l~v~~g~F  215 (240)
                      .||.||.++.+..|.|
T Consensus       647 ~~P~cg~~i~~r~Gr~  662 (859)
T PRK07561        647 ADPECGTAMVLRSGRF  662 (859)
T ss_pred             CCCCCCCeeEEecCCC
Confidence            5799999999998876


No 239
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=54.67  E-value=11  Score=37.67  Aligned_cols=22  Identities=23%  Similarity=0.546  Sum_probs=17.5

Q ss_pred             CCCCCCCccccccccceeecCCCCc
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      -.|-.|||++.   .-.-+||+||+
T Consensus         8 f~C~~CG~~s~---KW~GkCp~Cg~   29 (456)
T COG1066           8 FVCQECGYVSP---KWLGKCPACGA   29 (456)
T ss_pred             EEcccCCCCCc---cccccCCCCCC
Confidence            46999999975   44568999994


No 240
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=54.34  E-value=4.6  Score=37.42  Aligned_cols=28  Identities=18%  Similarity=0.554  Sum_probs=21.3

Q ss_pred             CCCCCCccccc--cccceeecCCCCceeee
Q 026283          183 ACPACKREFIG--SKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       183 ~CPvC~~eFtG--~nnt~~~CpnCGe~l~v  210 (240)
                      .||.|+.-..-  +....-.||+||--...
T Consensus        28 ~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        28 KCPKCGQVLYTKELERNLEVCPKCDHHMRM   57 (285)
T ss_pred             ECCCCcchhhHHHHHhhCCCCCCCCCcCcC
Confidence            69999987765  44455789999987654


No 241
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=54.10  E-value=6.3  Score=31.91  Aligned_cols=26  Identities=27%  Similarity=0.533  Sum_probs=21.8

Q ss_pred             CCCCCCCccccccccceee-----------cCCCCce
Q 026283          182 GACPACKREFIGSKSQIIR-----------CAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~-----------CpnCGe~  207 (240)
                      -.||.|+++=..|.+.|++           |..||..
T Consensus        73 ~~CpkCg~~ea~y~~~QtRsaDEp~T~Fy~C~~Cg~~  109 (113)
T COG1594          73 EKCPKCGNKEAYYWQLQTRSADEPETRFYKCTRCGYR  109 (113)
T ss_pred             ccCCCCCCceeEEEeeehhccCCCceEEEEecccCCE
Confidence            4699999999999998876           8888864


No 242
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=53.98  E-value=7.6  Score=33.94  Aligned_cols=25  Identities=28%  Similarity=0.595  Sum_probs=14.9

Q ss_pred             CCCCCCCccccccccc-------e----eecCCCCc
Q 026283          182 GACPACKREFIGSKSQ-------I----IRCAGCGN  206 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt-------~----~~CpnCGe  206 (240)
                      +.||-|+++=|-.-.+       .    -.|++||+
T Consensus         1 M~CPfC~~~~tkViDSR~~edg~aIRRRReC~~C~~   36 (156)
T COG1327           1 MKCPFCGHEDTKVIDSRPAEEGNAIRRRRECLECGE   36 (156)
T ss_pred             CCCCCCCCCCCeeeecccccccchhhhhhccccccc
Confidence            4688888765543222       1    24888875


No 243
>COG1503 eRF1 Peptide chain release factor 1 (eRF1) [Translation, ribosomal structure and biogenesis]
Probab=53.80  E-value=6.6  Score=38.66  Aligned_cols=32  Identities=28%  Similarity=0.619  Sum_probs=21.6

Q ss_pred             hcCCCCCCCcccccc--ccc--eeecCCCCceeeee
Q 026283          180 IKGACPACKREFIGS--KSQ--IIRCAGCGNIVWQP  211 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~--nnt--~~~CpnCGe~l~v~  211 (240)
                      ++-.||.|++++.=-  .+.  ..+||.||.+....
T Consensus       326 ~~~~c~~~~~e~~~t~~~~~~~~~~~~~~~~e~~~v  361 (411)
T COG1503         326 VTYKCPTCGYENLKSKREFEQKRFRCPECGSEMEEV  361 (411)
T ss_pred             eeecCCCcchhhhhcccccccccccCccccccccch
Confidence            466899999998321  111  23999999876543


No 244
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=53.55  E-value=2.4  Score=28.35  Aligned_cols=28  Identities=29%  Similarity=0.683  Sum_probs=16.6

Q ss_pred             CCCCCcccccc-----ccceeecCCCCceeeee
Q 026283          184 CPACKREFIGS-----KSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       184 CPvC~~eFtG~-----nnt~~~CpnCGe~l~v~  211 (240)
                      |+.|..|+.--     .-+-+-|++||=.+++-
T Consensus         2 C~~C~~Ey~~p~~RR~~~~~isC~~CGPr~~i~   34 (35)
T PF07503_consen    2 CDDCLKEYFDPSNRRFHYQFISCTNCGPRYSII   34 (35)
T ss_dssp             -HHHHHHHCSTTSTTTT-TT--BTTCC-SCCCE
T ss_pred             CHHHHHHHcCCCCCcccCcCccCCCCCCCEEEe
Confidence            77787777653     34668899999877653


No 245
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=53.33  E-value=45  Score=23.93  Aligned_cols=19  Identities=21%  Similarity=0.317  Sum_probs=15.1

Q ss_pred             cccccceeecCCCCceeee
Q 026283          192 IGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       192 tG~nnt~~~CpnCGe~l~v  210 (240)
                      .++++..-.||+||..|-+
T Consensus        46 ~~~kd~~H~Cp~C~~~lg~   64 (67)
T smart00714       46 DSFKDVNHYCPNCGAFLGT   64 (67)
T ss_pred             ccccCccEECCCCCCEeEE
Confidence            4678888899999988754


No 246
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=53.28  E-value=4  Score=30.10  Aligned_cols=15  Identities=33%  Similarity=0.826  Sum_probs=11.9

Q ss_pred             hhhcCCCCCCCcccc
Q 026283          178 FVIKGACPACKREFI  192 (240)
Q Consensus       178 nLIeg~CPvC~~eFt  192 (240)
                      .|-+--||||+++|+
T Consensus         9 ~lp~KICpvCqRPFs   23 (54)
T COG4338           9 TLPDKICPVCQRPFS   23 (54)
T ss_pred             ccchhhhhhhcCchH
Confidence            355667999999996


No 247
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=53.22  E-value=8.8  Score=40.06  Aligned_cols=25  Identities=16%  Similarity=0.348  Sum_probs=18.5

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeeeeCC
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      .-.|+.|||-+        +||||.-.++..+.
T Consensus       435 ~l~C~~Cg~v~--------~Cp~Cd~~lt~H~~  459 (730)
T COG1198         435 LLLCRDCGYIA--------ECPNCDSPLTLHKA  459 (730)
T ss_pred             eeecccCCCcc--------cCCCCCcceEEecC
Confidence            34699998854        68888888777664


No 248
>PRK14973 DNA topoisomerase I; Provisional
Probab=53.07  E-value=10  Score=40.44  Aligned_cols=16  Identities=13%  Similarity=0.034  Sum_probs=12.2

Q ss_pred             ecCCCCc--eeeeeCCCc
Q 026283          200 RCAGCGN--IVWQPEGDF  215 (240)
Q Consensus       200 ~CpnCGe--~l~v~~g~F  215 (240)
                      .||.||.  ++.+..|+|
T Consensus       637 ~Cp~CG~p~~~~~r~Gr~  654 (936)
T PRK14973        637 VCPIHHLNHVRLIRKGAR  654 (936)
T ss_pred             CCCCCCCCceEEeecCCC
Confidence            5999997  555678875


No 249
>PF03563 Bunya_G2:  Bunyavirus glycoprotein G2;  InterPro: IPR005168 Bunyavirus has three genomic segments: small (S), middle-sized (M), and large (L). The S segment encodes the nucleocapsid and a non-structural protein. The M segment codes for two glycoproteins, G1 and G2, and another non-structural protein (NSm). The L segment codes for an RNA polymerase. This entry represents the polyprotein region forming the G2 glycoprotein, which interacts with the IPR005167 from INTERPRO G1 glycoprotein [].
Probab=52.84  E-value=52  Score=31.31  Aligned_cols=55  Identities=20%  Similarity=0.405  Sum_probs=35.9

Q ss_pred             HHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH--HHHHHhhhhhcCCCCCCCcccccccc
Q 026283          140 TIFFLWFALSGWLFRILI----LATWVLPIAAPLL--IGTVANNFVIKGACPACKREFIGSKS  196 (240)
Q Consensus       140 tl~~~wll~SGWLvn~~l----~l~~vlPvaap~l--i~wWlkRnLIeg~CPvC~~eFtG~nn  196 (240)
                      +|+++.|.+.+-++-.+|    +.-+++|+..|+.  -||..||--  -.||.|+-..-=|-|
T Consensus       189 lIil~~~~~~~~i~~~IltktYi~YlliPiF~P~~~~Yg~~ynk~c--k~C~nC~La~HPFtn  249 (285)
T PF03563_consen  189 LIILTCLTLIIFIFLIILTKTYICYLLIPIFYPIAYLYGWLYNKSC--KKCKNCGLAYHPFTN  249 (285)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh--hhCcccCeeccCCCC
Confidence            444455555555555554    7778899999988  678888754  468888755444433


No 250
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=52.72  E-value=7.9  Score=34.25  Aligned_cols=30  Identities=27%  Similarity=0.428  Sum_probs=23.9

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeeeCCC
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      -.|-.|+..|.   --.-.||.||-++....-.
T Consensus       140 ~rC~GC~~~f~---~~~~~Cp~CG~~~~~~~~~  169 (177)
T COG1439         140 LRCHGCKRIFP---EPKDFCPICGSPLKRKRVK  169 (177)
T ss_pred             EEEecCceecC---CCCCcCCCCCCceEEeeec
Confidence            36999999999   4456799999998776543


No 251
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=52.61  E-value=13  Score=31.05  Aligned_cols=27  Identities=22%  Similarity=0.334  Sum_probs=19.9

Q ss_pred             eecCCCCceeeeeCCCcccCCCCCCCCCCCCCCeeeeec
Q 026283          199 IRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDVDF  237 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtIDVe~  237 (240)
                      -.||+||..|-|+-=.            +--|-|.|+|.
T Consensus        75 yyCP~Cgt~levE~~~------------Pg~P~~hD~ep  101 (112)
T PF08882_consen   75 YYCPGCGTQLEVEAPP------------PGYPPIHDFEP  101 (112)
T ss_pred             EECCCCcceeEEccCC------------CCCCceEeccc
Confidence            4699999999998642            44566777664


No 252
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=52.35  E-value=4.5  Score=36.44  Aligned_cols=24  Identities=33%  Similarity=0.666  Sum_probs=11.0

Q ss_pred             CCCCCCccccccccceeecCCCCceee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      .|..|+.+--=   ....||+|||.=.
T Consensus       199 ~Cs~C~t~W~~---~R~~Cp~Cg~~~~  222 (290)
T PF04216_consen  199 HCSLCGTEWRF---VRIKCPYCGNTDH  222 (290)
T ss_dssp             EETTT--EEE-----TTS-TTT---SS
T ss_pred             EcCCCCCeeee---cCCCCcCCCCCCC
Confidence            58888877633   3456888888633


No 253
>PHA02998 RNA polymerase subunit; Provisional
Probab=52.33  E-value=8.2  Score=34.77  Aligned_cols=33  Identities=24%  Similarity=0.527  Sum_probs=25.1

Q ss_pred             hcCCCCCCCccccccccceee-----------cCCCCceeeeeC
Q 026283          180 IKGACPACKREFIGSKSQIIR-----------CAGCGNIVWQPE  212 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~-----------CpnCGe~l~v~~  212 (240)
                      ++-.||.|++.=+-+-+-|+|           |.+||..-.-|.
T Consensus       142 t~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wkppk  185 (195)
T PHA02998        142 YNTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFKPPK  185 (195)
T ss_pred             cCCCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccCCcc
Confidence            556899999988887777764           999998655443


No 254
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=52.28  E-value=6.5  Score=29.78  Aligned_cols=25  Identities=28%  Similarity=0.582  Sum_probs=21.1

Q ss_pred             hcCCCCCCCccccccccceeecCCCCc
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      ..--|.-||..  .|+.|.-+|.+||-
T Consensus        16 tHt~CrRCG~~--syh~qK~~CasCGy   40 (62)
T PRK04179         16 THIRCRRCGRH--SYNVRKKYCAACGF   40 (62)
T ss_pred             ccchhcccCcc--cccccccchhhcCC
Confidence            44579999987  78999999999996


No 255
>PLN03121 nucleic acid binding protein; Provisional
Probab=52.20  E-value=19  Score=33.30  Aligned_cols=49  Identities=12%  Similarity=0.218  Sum_probs=36.3

Q ss_pred             HHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhhhhhhHhHHhhhhhhhhh
Q 026283           66 DAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRMDFSRN  118 (240)
Q Consensus        66 ear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~fgi~rR~R~f~~D~~r~  118 (240)
                      -|.....+||++.-+|.|++.-.    +..+++|++|.+.-+-+++..-.-++
T Consensus       153 ~a~a~v~~~d~~iglt~k~~~g~----~~vk~vDeky~vs~~tksA~~aa~~~  201 (243)
T PLN03121        153 TAAAKVAELSKRIGLTDKIFAGM----EAVRSVDEKYHVSEFTKSAATATGRT  201 (243)
T ss_pred             hhhhhhhhhhhhccchhhhhhhH----HHHHhhhhhhhhHHHHHHHHHHHHHH
Confidence            34445557777777777777655    66799999999999999877766553


No 256
>PLN02610 probable methionyl-tRNA synthetase
Probab=52.09  E-value=5.5  Score=41.56  Aligned_cols=30  Identities=23%  Similarity=0.784  Sum_probs=18.8

Q ss_pred             HhhhhhcCCCCC--CCccccccccceeecCCCCcee
Q 026283          175 ANNFVIKGACPA--CKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       175 lkRnLIeg~CPv--C~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      |-...|+|.||.  |+++=    ..--||-+||..+
T Consensus       149 l~d~~v~G~CP~~~C~~~~----a~Gd~Ce~Cg~~~  180 (801)
T PLN02610        149 LADRLVEGTCPTEGCNYDS----ARGDQCEKCGKLL  180 (801)
T ss_pred             cchHHhcCcCCccccCccc----cccchhhhccccC
Confidence            334467899999  87762    2234677777533


No 257
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=52.03  E-value=7.8  Score=34.84  Aligned_cols=15  Identities=13%  Similarity=0.211  Sum_probs=11.1

Q ss_pred             hhhcCCCCCCCcccc
Q 026283          178 FVIKGACPACKREFI  192 (240)
Q Consensus       178 nLIeg~CPvC~~eFt  192 (240)
                      |+-+..|+.|++++.
T Consensus       115 ~~~~~~C~~C~~~~~  129 (260)
T cd01409         115 SLHRVVCLSCGFRTP  129 (260)
T ss_pred             ecCEEEeCCCcCccC
Confidence            344567999999874


No 258
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=51.93  E-value=6.6  Score=24.02  Aligned_cols=9  Identities=56%  Similarity=1.549  Sum_probs=7.6

Q ss_pred             CCCCCCccc
Q 026283          183 ACPACKREF  191 (240)
Q Consensus       183 ~CPvC~~eF  191 (240)
                      .||.|++.|
T Consensus         4 ~C~~CgR~F   12 (25)
T PF13913_consen    4 PCPICGRKF   12 (25)
T ss_pred             cCCCCCCEE
Confidence            688888888


No 259
>TIGR00575 dnlj DNA ligase, NAD-dependent. The member of this family from Treponema pallidum differs in having three rather than just one copy of the BRCT (BRCA1 C Terminus) domain (pfam00533) at the C-terminus. It is included in the seed.
Probab=51.87  E-value=4.5  Score=41.21  Aligned_cols=40  Identities=28%  Similarity=0.598  Sum_probs=27.1

Q ss_pred             hcCCCCCCCcccccc-ccceeecC--CCCceeeeeCCCcccCC
Q 026283          180 IKGACPACKREFIGS-KSQIIRCA--GCGNIVWQPEGDFFSRN  219 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~-nnt~~~Cp--nCGe~l~v~~g~F~s~~  219 (240)
                      .-..||+|+.+++=- +....+|+  +|-..+...=-||.|+.
T Consensus       391 ~P~~CP~C~s~l~~~~~~~~~~C~n~~C~aq~~~~l~hf~sr~  433 (652)
T TIGR00575       391 FPTHCPSCGSPLVKIEEEAVIRCPNLNCPAQRVERIKHFASRN  433 (652)
T ss_pred             CCCCCCCCCCEeEecCCcEEEEECCCCCHHHHHHHhHHhhcCC
Confidence            447999999988642 33567886  57776665556885543


No 260
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=51.84  E-value=22  Score=29.30  Aligned_cols=42  Identities=31%  Similarity=0.615  Sum_probs=31.2

Q ss_pred             HHHhhhhhc-CCCCCCCccc---ccc--c-cceeecCCCCceeeeeCCC
Q 026283          173 TVANNFVIK-GACPACKREF---IGS--K-SQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       173 wWlkRnLIe-g~CPvC~~eF---tG~--n-nt~~~CpnCGe~l~v~~g~  214 (240)
                      ....+..+. -.||-|+.+-   .|.  + -|--+|++|+-..+.+.|.
T Consensus        21 ~~~~~~~~~~~~cP~C~s~~~~k~g~~~~~~qRyrC~~C~~tf~~~~~~   69 (129)
T COG3677          21 AYAIRMQITKVNCPRCKSSNVVKIGGIRRGHQRYKCKSCGSTFTVETGS   69 (129)
T ss_pred             HHHHhhhcccCcCCCCCccceeeECCccccccccccCCcCcceeeeccC
Confidence            344556666 7999999877   122  2 4677899999999999985


No 261
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=51.81  E-value=8.8  Score=26.33  Aligned_cols=25  Identities=24%  Similarity=0.716  Sum_probs=15.3

Q ss_pred             CCCCCCcccc---------ccccceeecCC--CCce
Q 026283          183 ACPACKREFI---------GSKSQIIRCAG--CGNI  207 (240)
Q Consensus       183 ~CPvC~~eFt---------G~nnt~~~Cpn--CGe~  207 (240)
                      .||.||..-.         .++..-.||.|  ||--
T Consensus         1 ~CP~Cg~~a~ir~S~~~s~~~~~~Y~qC~N~~Cg~t   36 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQLSPLTRELYCQCTNPECGHT   36 (47)
T ss_pred             CcCCCCCeeEEEEchhhCcceEEEEEEECCCcCCCE
Confidence            4777776432         44556677777  7753


No 262
>PRK11463 fxsA phage T7 F exclusion suppressor FxsA; Reviewed
Probab=51.73  E-value=71  Score=26.95  Aligned_cols=31  Identities=16%  Similarity=-0.008  Sum_probs=18.6

Q ss_pred             HHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHH
Q 026283          142 FFLWFALS-GWLFRILILATWVLPIAAPLLIG  172 (240)
Q Consensus       142 ~~~wll~S-GWLvn~~l~l~~vlPvaap~li~  172 (240)
                      ++..+|+. =-++-.++++++++|..--++-+
T Consensus        78 ~~gg~LLi~PGf~tD~~Gllll~P~~R~~~~~  109 (148)
T PRK11463         78 AVAGVLLLLPGFVTDILGLLLLLPPTRALLRP  109 (148)
T ss_pred             HHHHHHHHccHHHHHHHHHHHHcchhHHHHHH
Confidence            34344333 34566777888888887555533


No 263
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=51.68  E-value=6.3  Score=29.19  Aligned_cols=11  Identities=27%  Similarity=0.706  Sum_probs=9.0

Q ss_pred             ecCCCCceeee
Q 026283          200 RCAGCGNIVWQ  210 (240)
Q Consensus       200 ~CpnCGe~l~v  210 (240)
                      -||+||+++-.
T Consensus         5 HC~~CG~~Ip~   15 (59)
T PF09889_consen    5 HCPVCGKPIPP   15 (59)
T ss_pred             cCCcCCCcCCc
Confidence            59999998864


No 264
>PF12279 DUF3619:  Protein of unknown function (DUF3619);  InterPro: IPR022064  This protein is found in bacteria. Proteins in this family are about 140 amino acids in length. This protein has two conserved sequence motifs: AAR and DDLP. 
Probab=51.45  E-value=76  Score=26.56  Aligned_cols=30  Identities=33%  Similarity=0.500  Sum_probs=21.6

Q ss_pred             HHHHHHhhhhh-----hhhhHhHHHHHHHHHHHHH
Q 026283           67 AKKTAERIDRQ-----YSVSRRLNSAARTAAVRAR   96 (240)
Q Consensus        67 ar~~a~r~D~~-----Y~vs~r~a~aa~~a~e~A~   96 (240)
                      |++++..||+.     ++++.|++.|=+.|-++.+
T Consensus         7 a~~i~~~Ld~~a~~Lp~~i~~RL~aAR~~ALa~~k   41 (131)
T PF12279_consen    7 ARRIARALDESADDLPPDISERLAAARRQALARKK   41 (131)
T ss_pred             HHHHHHHhhcccccCCHHHHHHHHHHHHHHHHhcc
Confidence            67778888774     7888998877666655543


No 265
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=51.30  E-value=7.1  Score=32.60  Aligned_cols=19  Identities=21%  Similarity=0.594  Sum_probs=14.1

Q ss_pred             cccccceeecCCCCceeee
Q 026283          192 IGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       192 tG~nnt~~~CpnCGe~l~v  210 (240)
                      ...+-.|.+|||||.+-++
T Consensus        63 lStkav~V~CP~C~K~TKm   81 (114)
T PF11023_consen   63 LSTKAVQVECPNCGKQTKM   81 (114)
T ss_pred             hcccceeeECCCCCChHhh
Confidence            3445578999999987654


No 266
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=51.18  E-value=8.3  Score=25.04  Aligned_cols=27  Identities=26%  Similarity=0.562  Sum_probs=22.8

Q ss_pred             CCCCCCCccccccccceeecCCCCcee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      ..|-+|+..+.|+-.+-.+|..|+-.+
T Consensus        12 ~~C~~C~~~i~~~~~~~~~C~~C~~~~   38 (50)
T cd00029          12 TFCDVCRKSIWGLFKQGLRCSWCKVKC   38 (50)
T ss_pred             CChhhcchhhhccccceeEcCCCCCch
Confidence            459999999999878889999997554


No 267
>PRK10445 endonuclease VIII; Provisional
Probab=51.01  E-value=9.6  Score=34.31  Aligned_cols=23  Identities=30%  Similarity=0.679  Sum_probs=12.1

Q ss_pred             CCCCCCCcccc----ccccceeecCCCC
Q 026283          182 GACPACKREFI----GSKSQIIRCAGCG  205 (240)
Q Consensus       182 g~CPvC~~eFt----G~nnt~~~CpnCG  205 (240)
                      ..||+||....    |- .+-..||+|+
T Consensus       236 ~~Cp~Cg~~I~~~~~~g-R~t~~CP~CQ  262 (263)
T PRK10445        236 EACERCGGIIEKTTLSS-RPFYWCPGCQ  262 (263)
T ss_pred             CCCCCCCCEeEEEEECC-CCcEECCCCc
Confidence            35777765432    22 3344577775


No 268
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity.
Probab=50.92  E-value=8.6  Score=33.94  Aligned_cols=34  Identities=24%  Similarity=0.668  Sum_probs=23.0

Q ss_pred             hhhhhcCCCCCCCccccc------c-ccceeecCCCCceee
Q 026283          176 NNFVIKGACPACKREFIG------S-KSQIIRCAGCGNIVW  209 (240)
Q Consensus       176 kRnLIeg~CPvC~~eFtG------~-nnt~~~CpnCGe~l~  209 (240)
                      .-|+-+-.|..|+..+.-      + +...-.||.||..|.
T Consensus       111 HG~l~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cgg~lr  151 (235)
T cd01408         111 HGSFATAHCIKCKHKYPGDWMREDIFNQEVPKCPRCGGLVK  151 (235)
T ss_pred             CcCCCccccccCCCcCCHHHHHHHHhCCCCccCCCCCCCcc
Confidence            445666789999987642      1 123568999997654


No 269
>COG4469 CoiA Competence protein CoiA-like family, contains a predicted nuclease    domain [General function prediction only]
Probab=50.79  E-value=8.3  Score=37.27  Aligned_cols=16  Identities=25%  Similarity=0.611  Sum_probs=14.4

Q ss_pred             eecCCCCceeeeeCCC
Q 026283          199 IRCAGCGNIVWQPEGD  214 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~  214 (240)
                      ..||.||++|-+.+|.
T Consensus        26 ffCPaC~~~l~lK~G~   41 (342)
T COG4469          26 FFCPACGSQLILKQGL   41 (342)
T ss_pred             cccCCCCCeeeeecCc
Confidence            5899999999999984


No 270
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=50.64  E-value=12  Score=25.34  Aligned_cols=24  Identities=29%  Similarity=0.751  Sum_probs=16.7

Q ss_pred             CCCCCCc-ccccccc-ceeecCCCCc
Q 026283          183 ACPACKR-EFIGSKS-QIIRCAGCGN  206 (240)
Q Consensus       183 ~CPvC~~-eFtG~nn-t~~~CpnCGe  206 (240)
                      .||-|+. +..-+++ ..-+|-+|+.
T Consensus        20 ~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   20 VCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            4999987 3444444 7788888874


No 271
>KOG3966 consensus p53-mediated apoptosis protein EI24/PIG8 [Signal transduction mechanisms; Defense mechanisms]
Probab=50.42  E-value=1.9e+02  Score=28.27  Aligned_cols=52  Identities=15%  Similarity=0.094  Sum_probs=36.2

Q ss_pred             HHhHHHHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhhhhhhHhHHhhhh
Q 026283           61 EQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFRM  113 (240)
Q Consensus        61 e~~~fear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~fgi~rR~R~f~~  113 (240)
                      |+...+.|.+++..-|.+-=|-+...+++--.|.|.++..| .=+|+.|+..+
T Consensus        18 qe~~~~~~~~~~D~arg~~ds~~gi~~v~iree~akq~~ee-~~~r~~~~vL~   69 (360)
T KOG3966|consen   18 QEHMVKFQIIARDFARGFIDSFKGITFVRIREEEAKQVKEE-PPKRVERTVLM   69 (360)
T ss_pred             HHHHHHHHHHHHHHhhcCCccccchhhhhhhHHHHHHhhhc-CCchHHHHHHh
Confidence            67777777777777777776777777777777777776554 33566666655


No 272
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=50.31  E-value=8.4  Score=38.07  Aligned_cols=29  Identities=24%  Similarity=0.674  Sum_probs=21.1

Q ss_pred             hcCCCCCCCccccccccceeecCCCCcee
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      +.-.||.||...-..-..-.+|+.||...
T Consensus       349 ~~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~  377 (421)
T COG1571         349 VNPVCPRCGGRMKSAGRNGFRCKKCGTRA  377 (421)
T ss_pred             cCCCCCccCCchhhcCCCCcccccccccC
Confidence            34579999987654433389999999754


No 273
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.25  E-value=6.8  Score=29.47  Aligned_cols=18  Identities=44%  Similarity=0.946  Sum_probs=16.6

Q ss_pred             eeecCCCCceeeeeCCCc
Q 026283          198 IIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g~F  215 (240)
                      .+.|.|||-++..+.-+|
T Consensus        34 kikC~nC~h~vm~pR~~F   51 (60)
T COG4481          34 KIKCENCGHSVMMPRYDF   51 (60)
T ss_pred             EEEecCCCcEEEecHHHH
Confidence            578999999999999888


No 274
>PRK08332 ribonucleotide-diphosphate reductase subunit alpha; Validated
Probab=50.09  E-value=13  Score=42.55  Aligned_cols=35  Identities=20%  Similarity=0.440  Sum_probs=23.3

Q ss_pred             HHHHhhhhhcCCCCCCCcc---cc--ccccceeecCCCCc
Q 026283          172 GTVANNFVIKGACPACKRE---FI--GSKSQIIRCAGCGN  206 (240)
Q Consensus       172 ~wWlkRnLIeg~CPvC~~e---Ft--G~nnt~~~CpnCGe  206 (240)
                      .+-+++-+....||+|+..   ++  =....-..||+||=
T Consensus      1695 ~~~~~~~~~~~~cp~c~~~~~~~~~~~~~~gc~~c~~cg~ 1734 (1740)
T PRK08332       1695 EEKIRELLGVVYCPVCYEKEGKLVELRMESGCATCPVCGW 1734 (1740)
T ss_pred             HHHHHHHhccCCCCCCCCCCCcceeeEecCCceeCCCCCC
Confidence            4556666677779999987   11  22333458999993


No 275
>PRK05333 NAD-dependent deacetylase; Provisional
Probab=50.00  E-value=8.2  Score=34.94  Aligned_cols=12  Identities=33%  Similarity=0.916  Sum_probs=9.4

Q ss_pred             eeecCCCCceee
Q 026283          198 IIRCAGCGNIVW  209 (240)
Q Consensus       198 ~~~CpnCGe~l~  209 (240)
                      .-.||+||.+|.
T Consensus       179 iP~C~~Cgg~lr  190 (285)
T PRK05333        179 VPACPACGGILK  190 (285)
T ss_pred             CCCCCCCCCccc
Confidence            357999998764


No 276
>TIGR03847 conserved hypothetical protein. The conserved hypothetical protein described here occurs as part of the trio of uncharacterized proteins common in the Actinobacteria.
Probab=49.94  E-value=7.5  Score=34.56  Aligned_cols=16  Identities=31%  Similarity=0.875  Sum_probs=12.9

Q ss_pred             eecCCCCceeeeeCCCc
Q 026283          199 IRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~F  215 (240)
                      -.||.||++| =++||+
T Consensus       157 P~CPlCg~Pl-dP~GH~  172 (177)
T TIGR03847       157 PPCPLCGRPI-DPDGHI  172 (177)
T ss_pred             CCCCCCCCCC-CCCCcc
Confidence            4689999998 567887


No 277
>PRK07561 DNA topoisomerase I subunit omega; Validated
Probab=49.69  E-value=19  Score=37.75  Aligned_cols=18  Identities=17%  Similarity=0.422  Sum_probs=13.7

Q ss_pred             eeecCCCCceeeeeCCCc
Q 026283          198 IIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g~F  215 (240)
                      .+-||.||+.+.+.+|.|
T Consensus       766 ~~g~p~~g~~i~~~~Gr~  783 (859)
T PRK07561        766 ELGCPKSGAPFVLRDGRY  783 (859)
T ss_pred             ccCCCCCCCeEEEecCCC
Confidence            455788888888888864


No 278
>COG5525 Bacteriophage tail assembly protein [General function prediction only]
Probab=48.97  E-value=9.7  Score=39.30  Aligned_cols=28  Identities=36%  Similarity=0.838  Sum_probs=21.3

Q ss_pred             CCCCCCcccc----------ccccce-----eecCCCCceeee
Q 026283          183 ACPACKREFI----------GSKSQI-----IRCAGCGNIVWQ  210 (240)
Q Consensus       183 ~CPvC~~eFt----------G~nnt~-----~~CpnCGe~l~v  210 (240)
                      .||.||+++.          |+.-..     ++|+.|+.++.+
T Consensus       229 pCPHCGe~q~l~~~e~~~~~g~~~~~~~~~~~~c~h~~~~i~~  271 (611)
T COG5525         229 PCPHCGEEQQLKFGEKSGPRGLKDTPAEAAFIQCEHCGCVIRP  271 (611)
T ss_pred             eCCCCCchhhccccccCCCcCcccchhhhhhhhccccCceeee
Confidence            6999999763          333333     499999999988


No 279
>KOG3096 consensus Spliceosome-associated coiled-coil protein [Function unknown]
Probab=48.64  E-value=74  Score=29.40  Aligned_cols=53  Identities=28%  Similarity=0.481  Sum_probs=40.4

Q ss_pred             HHHHHhhHHHHHhHHHHHHHHHhhhhhh-hhhHhHHHHHHHHHHHHHHhhhhhh
Q 026283           51 DAWRTANNGFEQLVFDAKKTAERIDRQY-SVSRRLNSAARTAAVRARELDREFA  103 (240)
Q Consensus        51 ~a~r~an~~~e~~~fear~~a~r~D~~Y-~vs~r~a~aa~~a~e~A~eiD~~fg  103 (240)
                      .||++-|+.+|-|...|.|.+++....- +|.+.=--+--+|.++.++++++++
T Consensus       127 eaw~~~ne~le~~l~~aqkelq~~kk~iq~vn~~RK~~Q~~ag~rL~~le~~wv  180 (225)
T KOG3096|consen  127 EAWKQYNEVLEVMLTHAQKELQKTKKLIQDVNRQRKHAQLTAGERLRELEQKWV  180 (225)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHH
Confidence            7999999999999999999988775432 3444444455678888888888764


No 280
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=48.54  E-value=9.6  Score=34.46  Aligned_cols=23  Identities=22%  Similarity=0.491  Sum_probs=13.1

Q ss_pred             CCCCCCcccccc---ccceeecCCCC
Q 026283          183 ACPACKREFIGS---KSQIIRCAGCG  205 (240)
Q Consensus       183 ~CPvC~~eFtG~---nnt~~~CpnCG  205 (240)
                      .||+||.+..-.   ..+-..||+|+
T Consensus       246 pCprCG~~I~~~~~~gR~t~~CP~CQ  271 (272)
T PRK14810        246 PCLNCKTPIRRVVVAGRSSHYCPHCQ  271 (272)
T ss_pred             cCCCCCCeeEEEEECCCccEECcCCc
Confidence            677777654311   13345677775


No 281
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=48.34  E-value=8.2  Score=27.22  Aligned_cols=14  Identities=29%  Similarity=0.695  Sum_probs=9.0

Q ss_pred             CCCCCCcccccccc
Q 026283          183 ACPACKREFIGSKS  196 (240)
Q Consensus       183 ~CPvC~~eFtG~nn  196 (240)
                      .|++|+|.+---.+
T Consensus         3 ~C~~CgyvYd~~~G   16 (47)
T PF00301_consen    3 QCPVCGYVYDPEKG   16 (47)
T ss_dssp             EETTTSBEEETTTB
T ss_pred             CCCCCCEEEcCCcC
Confidence            57777776655443


No 282
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=48.24  E-value=10  Score=34.15  Aligned_cols=23  Identities=22%  Similarity=0.625  Sum_probs=14.1

Q ss_pred             CCCCCCcccc----ccccceeecCCCCc
Q 026283          183 ACPACKREFI----GSKSQIIRCAGCGN  206 (240)
Q Consensus       183 ~CPvC~~eFt----G~nnt~~~CpnCGe  206 (240)
                      .||+||....    | ..+-..||+|+.
T Consensus       247 pC~~Cg~~I~~~~~~-gR~t~~CP~CQ~  273 (274)
T PRK01103        247 PCRRCGTPIEKIKQG-GRSTFFCPRCQK  273 (274)
T ss_pred             CCCCCCCeeEEEEEC-CCCcEECcCCCC
Confidence            4888886532    2 234566888864


No 283
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=48.16  E-value=11  Score=24.69  Aligned_cols=24  Identities=29%  Similarity=0.928  Sum_probs=15.8

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      |.||+|..+|.. .......+ ||-.
T Consensus         1 d~C~IC~~~~~~-~~~~~~l~-C~H~   24 (44)
T PF13639_consen    1 DECPICLEEFED-GEKVVKLP-CGHV   24 (44)
T ss_dssp             -CETTTTCBHHT-TSCEEEET-TSEE
T ss_pred             CCCcCCChhhcC-CCeEEEcc-CCCe
Confidence            689999999976 44444555 7643


No 284
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=48.05  E-value=8.5  Score=26.75  Aligned_cols=25  Identities=28%  Similarity=0.602  Sum_probs=15.9

Q ss_pred             hcCCCCCCCcccccccc----ceeecCCC
Q 026283          180 IKGACPACKREFIGSKS----QIIRCAGC  204 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nn----t~~~CpnC  204 (240)
                      |-=.||.|++++..-=+    ....||-|
T Consensus        27 v~W~C~~Cgh~w~~~v~~R~~~~~~CP~C   55 (55)
T PF14311_consen   27 VWWKCPKCGHEWKASVNDRTRRGKGCPYC   55 (55)
T ss_pred             EEEECCCCCCeeEccHhhhccCCCCCCCC
Confidence            33468999888876322    24567776


No 285
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=47.85  E-value=8  Score=28.91  Aligned_cols=12  Identities=25%  Similarity=0.498  Sum_probs=8.8

Q ss_pred             eeecCCCCceee
Q 026283          198 IIRCAGCGNIVW  209 (240)
Q Consensus       198 ~~~CpnCGe~l~  209 (240)
                      .-.|||||..|.
T Consensus        41 ~~~CPNCgGelv   52 (57)
T PF06906_consen   41 NGVCPNCGGELV   52 (57)
T ss_pred             cCcCcCCCCccc
Confidence            457999987764


No 286
>COG1328 NrdD Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism]
Probab=47.79  E-value=9.6  Score=39.73  Aligned_cols=24  Identities=25%  Similarity=0.646  Sum_probs=17.5

Q ss_pred             cCCCCCCCccccccccceeecCCCCce
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      -+-|+-|++.--|+--.   ||+||+.
T Consensus       641 i~~C~~cg~~~~~~~~~---Cp~CG~~  664 (700)
T COG1328         641 ISVCNRCGYSGEGLRTR---CPKCGSE  664 (700)
T ss_pred             ceeeccCCccccccccc---CCCCCCc
Confidence            46899999975444333   9999955


No 287
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=47.75  E-value=6.8  Score=21.46  Aligned_cols=12  Identities=33%  Similarity=1.013  Sum_probs=7.0

Q ss_pred             CCCCCCcccccc
Q 026283          183 ACPACKREFIGS  194 (240)
Q Consensus       183 ~CPvC~~eFtG~  194 (240)
                      .||.|++.|...
T Consensus         2 ~C~~C~~~~~~~   13 (24)
T PF13894_consen    2 QCPICGKSFRSK   13 (24)
T ss_dssp             E-SSTS-EESSH
T ss_pred             CCcCCCCcCCcH
Confidence            488888887643


No 288
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.35  E-value=21  Score=28.15  Aligned_cols=24  Identities=33%  Similarity=0.510  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHhhhhhcCCCC
Q 026283          162 VLPIAAPLLIGTVANNFVIKGACP  185 (240)
Q Consensus       162 vlPvaap~li~wWlkRnLIeg~CP  185 (240)
                      ++-+++...+|.+.+|.-|.|.|-
T Consensus        11 Fllvi~gMsiG~I~krk~I~GSCG   34 (77)
T COG2991          11 FLLVIAGMSIGYIFKRKSIKGSCG   34 (77)
T ss_pred             HHHHHHHHhHhhheeccccccccc
Confidence            344455667999999999999996


No 289
>KOG3134 consensus Predicted membrane protein [Function unknown]
Probab=47.24  E-value=6.5  Score=36.09  Aligned_cols=14  Identities=21%  Similarity=0.845  Sum_probs=12.0

Q ss_pred             ccceeecCCCCcee
Q 026283          195 KSQIIRCAGCGNIV  208 (240)
Q Consensus       195 nnt~~~CpnCGe~l  208 (240)
                      |.+..+||||+|++
T Consensus        21 ~irlt~C~nC~e~v   34 (225)
T KOG3134|consen   21 NIRLTKCPNCQEVV   34 (225)
T ss_pred             cEEEeeCCchhhHH
Confidence            67788999999975


No 290
>PRK03922 hypothetical protein; Provisional
Probab=46.99  E-value=8.5  Score=32.14  Aligned_cols=18  Identities=17%  Similarity=0.604  Sum_probs=11.3

Q ss_pred             ccccccceeecCCCCcee
Q 026283          191 FIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       191 FtG~nnt~~~CpnCGe~l  208 (240)
                      |+-..-....||.|||++
T Consensus        42 yVeievG~~~cP~cge~~   59 (113)
T PRK03922         42 YVEVEVGLTICPKCGEPF   59 (113)
T ss_pred             eEEEecCcccCCCCCCcC
Confidence            444455566777777765


No 291
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=46.91  E-value=39  Score=32.43  Aligned_cols=10  Identities=20%  Similarity=0.866  Sum_probs=7.7

Q ss_pred             eeecCCCCce
Q 026283          198 IIRCAGCGNI  207 (240)
Q Consensus       198 ~~~CpnCGe~  207 (240)
                      .+.|-|||+.
T Consensus       225 R~KC~nC~~t  234 (308)
T COG3058         225 RVKCSNCEQS  234 (308)
T ss_pred             HHHhcccccc
Confidence            3579999975


No 292
>PF06054 CoiA:  Competence protein CoiA-like family;  InterPro: IPR010330 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterised protein.
Probab=46.90  E-value=12  Score=35.39  Aligned_cols=19  Identities=32%  Similarity=0.625  Sum_probs=17.0

Q ss_pred             cceeecCCCCceeeeeCCC
Q 026283          196 SQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       196 nt~~~CpnCGe~l~v~~g~  214 (240)
                      +....||.||++|....|.
T Consensus        28 ~~~~~CP~C~~~v~lk~G~   46 (375)
T PF06054_consen   28 KGKYFCPGCGEPVILKKGK   46 (375)
T ss_pred             CCcEECCCCCCeeEEEEcC
Confidence            6788999999999999885


No 293
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. This enzyme is responsible for two methylations of a characteristic guanine of most tRNA molecules. The activity has been demonstrated for eukaryotic and archaeal proteins, which are active when expressed in E. coli, a species that lacks this enzyme. At least one Eubacterium, Aquifex aeolicus, has an ortholog, as do all completed archaeal genomes.
Probab=46.79  E-value=11  Score=35.87  Aligned_cols=30  Identities=23%  Similarity=0.431  Sum_probs=20.7

Q ss_pred             cCCCCCCCccc--cccccceeecCCCCceeee
Q 026283          181 KGACPACKREF--IGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       181 eg~CPvC~~eF--tG~nnt~~~CpnCGe~l~v  210 (240)
                      -..||.|++.-  .|+....-.||.||..+.+
T Consensus       233 v~~C~~c~~~~~~~~~~~~~~~C~~c~~~~~~  264 (374)
T TIGR00308       233 TYHCSRCLHNKPVNGISQRKGRCKECGGEYHL  264 (374)
T ss_pred             EEECCCcccccccccccCCCCCCCCCCCccee
Confidence            45799998742  2344555689999987654


No 294
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=46.70  E-value=27  Score=23.56  Aligned_cols=25  Identities=28%  Similarity=0.713  Sum_probs=17.8

Q ss_pred             CCC--CCCcccccc---ccceeecCCCCce
Q 026283          183 ACP--ACKREFIGS---KSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CP--vC~~eFtG~---nnt~~~CpnCGe~  207 (240)
                      -||  -|++-..--   ......||.||-.
T Consensus        20 ~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~   49 (64)
T smart00647       20 WCPAPDCSAAIIVTEEEGCNRVTCPKCGFS   49 (64)
T ss_pred             CCCCCCCcceEEecCCCCCCeeECCCCCCe
Confidence            488  887766554   5678888888754


No 295
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=46.37  E-value=12  Score=23.90  Aligned_cols=26  Identities=31%  Similarity=0.623  Sum_probs=20.8

Q ss_pred             cCCCCCCCccccccccceeecCCCCce
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      ...|-+|+..+.|+. +-.+|+.|+-.
T Consensus        11 ~~~C~~C~~~i~~~~-~~~~C~~C~~~   36 (49)
T smart00109       11 PTKCCVCRKSIWGSF-QGLRCSWCKVK   36 (49)
T ss_pred             CCCccccccccCcCC-CCcCCCCCCch
Confidence            345999999999876 67899999743


No 296
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=46.29  E-value=10  Score=31.24  Aligned_cols=14  Identities=21%  Similarity=0.444  Sum_probs=12.0

Q ss_pred             cCCCCceeeeeCCC
Q 026283          201 CAGCGNIVWQPEGD  214 (240)
Q Consensus       201 CpnCGe~l~v~~g~  214 (240)
                      ||.||..|.|..=+
T Consensus         1 CPvCg~~l~vt~l~   14 (113)
T PF09862_consen    1 CPVCGGELVVTRLK   14 (113)
T ss_pred             CCCCCCceEEEEEE
Confidence            99999999998633


No 297
>PRK02935 hypothetical protein; Provisional
Probab=45.84  E-value=8.6  Score=31.99  Aligned_cols=19  Identities=16%  Similarity=0.293  Sum_probs=14.6

Q ss_pred             cccceeecCCCCceeeeeC
Q 026283          194 SKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       194 ~nnt~~~CpnCGe~l~v~~  212 (240)
                      -+-.|.+||||+.+-++=.
T Consensus        66 tkavqV~CP~C~K~TKmLG   84 (110)
T PRK02935         66 TKAVQVICPSCEKPTKMLG   84 (110)
T ss_pred             ccceeeECCCCCchhhhcc
Confidence            4556889999999877643


No 298
>KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis]
Probab=45.79  E-value=15  Score=29.31  Aligned_cols=34  Identities=29%  Similarity=0.705  Sum_probs=26.6

Q ss_pred             cCCCCCCCcccccc--ccceeecCCCCceeeeeCCC
Q 026283          181 KGACPACKREFIGS--KSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       181 eg~CPvC~~eFtG~--nnt~~~CpnCGe~l~v~~g~  214 (240)
                      .-.||-|-+--+-|  -+++..|+||+.++-|+-|.
T Consensus        34 ~VkC~gc~~iT~vfSHaqtvVvc~~c~~il~~~tgg   69 (84)
T KOG1779|consen   34 DVKCPGCFKITTVFSHAQTVVVCEGCSTILCQPTGG   69 (84)
T ss_pred             EEEcCCceEEEEEeecCceEEEcCCCceEEEEecCC
Confidence            34699987765555  46788999999999998774


No 299
>PF12653 DUF3785:  Protein of unknown function (DUF3785);  InterPro: IPR024210 This family of proteins is functionally uncharacterised. Proteins in this family are approximately 140 amino acids in length and share two CXXC motifs suggesting these are zinc binding proteins. In clostridia proteins are found in an operon with three signalling proteins, suggesting that they are involved in DNA-binding transcription regulator downstream of an as yet unknown signalling pathway.
Probab=45.59  E-value=9.8  Score=32.67  Aligned_cols=12  Identities=50%  Similarity=1.071  Sum_probs=9.9

Q ss_pred             ceeecCCCCcee
Q 026283          197 QIIRCAGCGNIV  208 (240)
Q Consensus       197 t~~~CpnCGe~l  208 (240)
                      +++.|||||+-.
T Consensus       119 si~VC~nCG~y~  130 (138)
T PF12653_consen  119 SIIVCPNCGNYS  130 (138)
T ss_pred             EEEECCCCCceE
Confidence            678999999843


No 300
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=45.37  E-value=27  Score=28.01  Aligned_cols=29  Identities=10%  Similarity=0.093  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHhhhhhcCCCCCCCccccc
Q 026283          165 IAAPLLIGTVANNFVIKGACPACKREFIG  193 (240)
Q Consensus       165 vaap~li~wWlkRnLIeg~CPvC~~eFtG  193 (240)
                      ++.++++-+..+|..-.|.=|.=+.....
T Consensus        13 ~l~~~~~~~~~rRR~r~G~~P~~gt~w~~   41 (130)
T PF12273_consen   13 LLFLFLFYCHNRRRRRRGLQPIYGTRWMA   41 (130)
T ss_pred             HHHHHHHHHHHHHHhhcCCCCcCCceecC
Confidence            33345566778888888888876666555


No 301
>KOG4218 consensus Nuclear hormone receptor betaFTZ-F1 [Transcription]
Probab=44.98  E-value=9.4  Score=37.77  Aligned_cols=29  Identities=21%  Similarity=0.600  Sum_probs=24.4

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCCc
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      +=.+.-|||||-.-.||.-.-..|.+|-.
T Consensus        12 edl~ElCPVCGDkVSGYHYGLLTCESCKG   40 (475)
T KOG4218|consen   12 EDLGELCPVCGDKVSGYHYGLLTCESCKG   40 (475)
T ss_pred             cccccccccccCccccceeeeeehhhhhh
Confidence            33456799999999999999999999964


No 302
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=44.92  E-value=12  Score=36.93  Aligned_cols=28  Identities=25%  Similarity=0.477  Sum_probs=20.4

Q ss_pred             CCCCCCCccccccccceeecCCCCceeeee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      ..||.|.+. -+ ..+.-.||+||......
T Consensus        58 ~kC~~c~~~-~~-y~~~~~C~~cg~~~~l~   85 (415)
T COG5257          58 YKCPECYRP-EC-YTTEPKCPNCGAETELV   85 (415)
T ss_pred             EeCCCCCCC-cc-cccCCCCCCCCCCccEE
Confidence            579999987 33 34566799999876443


No 303
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic
Probab=44.60  E-value=11  Score=31.71  Aligned_cols=39  Identities=23%  Similarity=0.565  Sum_probs=25.2

Q ss_pred             hhhhcCCCCCCCccccccc----cceeecCCCCceeeeeCCCc
Q 026283          177 NFVIKGACPACKREFIGSK----SQIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG~n----nt~~~CpnCGe~l~v~~g~F  215 (240)
                      -++-+..|..|+..+.--.    +....||.||.+|.-.--.|
T Consensus       109 G~~~~~~C~~C~~~~~~~~~~~~~~~p~C~~C~~~l~p~v~~f  151 (222)
T cd00296         109 GSLDRVRCTSCGKEYPRDEVLEREKPPRCPKCGGLLRPDVVDF  151 (222)
T ss_pred             CCCCccEECCCCCCcchhhhhhccCCCCCCCCCCcccCceEEC
Confidence            3455678999986653322    34578999998875444444


No 304
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=44.58  E-value=7.3  Score=41.70  Aligned_cols=28  Identities=29%  Similarity=0.668  Sum_probs=0.0

Q ss_pred             CCCCCCCcccccccc--------ceeecCCCCceee
Q 026283          182 GACPACKREFIGSKS--------QIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFtG~nn--------t~~~CpnCGe~l~  209 (240)
                      -.||.|+.+-....-        ..-.||.||..+.
T Consensus       656 r~Cp~Cg~~t~~~~Cp~CG~~T~~~~~Cp~C~~~~~  691 (900)
T PF03833_consen  656 RRCPKCGKETFYNRCPECGSHTEPVYVCPDCGIEVE  691 (900)
T ss_dssp             ------------------------------------
T ss_pred             ccCcccCCcchhhcCcccCCccccceeccccccccC
Confidence            468888876433221        2335666666553


No 305
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=44.56  E-value=11  Score=42.46  Aligned_cols=22  Identities=27%  Similarity=0.572  Sum_probs=17.7

Q ss_pred             cCCCCCCCccccccccceeecCCCCce
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .-.||.|+.+     .-..+||.||..
T Consensus       674 ~~~Cp~Cg~~-----~~~~~Cp~CG~~  695 (1627)
T PRK14715        674 FFKCPKCGKV-----GLYHVCPFCGTR  695 (1627)
T ss_pred             eeeCCCCCCc-----cccccCcccCCc
Confidence            3579999987     345689999987


No 306
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=44.55  E-value=7.8  Score=25.02  Aligned_cols=25  Identities=24%  Similarity=0.565  Sum_probs=10.5

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCC
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCG  205 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCG  205 (240)
                      .|+-..|+.|+.-+.   --...||+||
T Consensus         8 ~l~~~rC~~Cg~~~~---pPr~~Cp~C~   32 (37)
T PF12172_consen    8 RLLGQRCRDCGRVQF---PPRPVCPHCG   32 (37)
T ss_dssp             -EEEEE-TTT--EEE---S--SEETTTT
T ss_pred             EEEEEEcCCCCCEec---CCCcCCCCcC
Confidence            345556666665532   2235666665


No 307
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=44.30  E-value=3.7  Score=35.90  Aligned_cols=25  Identities=20%  Similarity=0.588  Sum_probs=19.4

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCCcee
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      .+.++-|.-||.+      +...||||+.++
T Consensus        25 ~~~~~fC~kCG~~------tI~~Cp~C~~~I   49 (158)
T PF10083_consen   25 ELREKFCSKCGAK------TITSCPNCSTPI   49 (158)
T ss_pred             hHHHHHHHHhhHH------HHHHCcCCCCCC
Confidence            4567778888865      678899998876


No 308
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=43.85  E-value=16  Score=27.99  Aligned_cols=29  Identities=21%  Similarity=0.510  Sum_probs=22.8

Q ss_pred             CCCCCCCccc---------cccccceeecC--CCCceeee
Q 026283          182 GACPACKREF---------IGSKSQIIRCA--GCGNIVWQ  210 (240)
Q Consensus       182 g~CPvC~~eF---------tG~nnt~~~Cp--nCGe~l~v  210 (240)
                      +.||.||..-         -+++..-.||.  +||.--+-
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~~~~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFIT   41 (72)
T ss_pred             ccCCCCCCccEEEEChhcChhhheeeeecCCCCCCCEEEE
Confidence            5799999765         36888899998  99986443


No 309
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG. Member of this ferredoxin-like protein family are found exclusively in species with an operon encoding the cbb3 type of cytochrome c oxidase (cco-cbb3), and near the cco-cbb3 operon in about half the cases. The cco-cbb3 is found in a variety of proteobacteria and almost nowhere else, and is associated with oxygen use under microaerobic conditions. Some (but not all) of these proteobacteria are also nitrogen-fixing, hence the gene symbol fixG. FixG was shown essential for functional cco-cbb3 expression in Bradyrhizobium japonicum.
Probab=43.71  E-value=37  Score=33.29  Aligned_cols=18  Identities=11%  Similarity=0.110  Sum_probs=13.1

Q ss_pred             HHHhhhhhcCCCCCCCcc
Q 026283          173 TVANNFVIKGACPACKRE  190 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~e  190 (240)
                      -|+++..=...||.-..+
T Consensus       177 ~~~re~~C~~~CP~g~~q  194 (434)
T TIGR02745       177 GWMREQFCIYMCPYARIQ  194 (434)
T ss_pred             HeeccchhhhhCCHHHHH
Confidence            388888888888855444


No 310
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=43.66  E-value=12  Score=27.36  Aligned_cols=35  Identities=17%  Similarity=0.334  Sum_probs=26.6

Q ss_pred             hcCCCCCCCcccc---ccccceeecCCCCceeeeeCCC
Q 026283          180 IKGACPACKREFI---GSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       180 Ieg~CPvC~~eFt---G~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      -|-.|+.|++-+.   ++..-++.||.||.+-.+..-.
T Consensus         3 ~eiRC~~CnklLa~~g~~~~leIKCpRC~tiN~~~a~~   40 (51)
T PF10122_consen    3 KEIRCGHCNKLLAKAGEVIELEIKCPRCKTINHVRATS   40 (51)
T ss_pred             cceeccchhHHHhhhcCccEEEEECCCCCccceEeccC
Confidence            4567999987653   3556799999999988776654


No 311
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=43.55  E-value=11  Score=36.66  Aligned_cols=25  Identities=20%  Similarity=0.485  Sum_probs=16.8

Q ss_pred             CCCCCCcccccccc---------c-------eeecCCCCce
Q 026283          183 ACPACKREFIGSKS---------Q-------IIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nn---------t-------~~~CpnCGe~  207 (240)
                      .|++|+|.+-.-.+         |       .-.||-||..
T Consensus       427 ~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        427 QCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             EECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCCc
Confidence            38888888766433         2       2378888864


No 312
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=42.92  E-value=14  Score=33.13  Aligned_cols=13  Identities=38%  Similarity=0.805  Sum_probs=10.2

Q ss_pred             cCCCCCCCccccc
Q 026283          181 KGACPACKREFIG  193 (240)
Q Consensus       181 eg~CPvC~~eFtG  193 (240)
                      .-.|||++.+|+|
T Consensus       113 ~~~CPvt~~~~~~  125 (260)
T PF04641_consen  113 RFICPVTGKEFNG  125 (260)
T ss_pred             eeECCCCCcccCC
Confidence            3469999998866


No 313
>PF01004 Flavi_M:  Flavivirus envelope glycoprotein M;  InterPro: IPR000069 Flaviviruses are small enveloped viruses with virions comprised of three proteins called C, M and E [, , ]. The envelope glycoprotein M is made as a precursor, called prM. The precursor portion of the protein is the signal peptide for the proteins entry into the membrane. prM is cleaved to form M in a late-stage cleavage event. Associated with this cleavage is a change in the infectivity and fusion activity of the virus.; GO: 0019058 viral infectious cycle, 0019028 viral capsid
Probab=42.89  E-value=31  Score=26.68  Aligned_cols=31  Identities=16%  Similarity=0.250  Sum_probs=22.9

Q ss_pred             CCCCchHHHHHHHHHHHHHHHHHHHHHHHHH
Q 026283          131 NTPLGRSFATIFFLWFALSGWLFRILILATW  161 (240)
Q Consensus       131 ~T~lG~wL~tl~~~wll~SGWLvn~~l~l~~  161 (240)
                      ...=|..++..++.|++++...=+.+|++++
T Consensus        37 lrNp~~al~a~~l~w~lg~s~~Qrvi~iill   67 (75)
T PF01004_consen   37 LRNPGYALAAVALAWMLGSSTTQRVIFIILL   67 (75)
T ss_pred             hcCchHHHHHHHHHHHHcCCchHHHHHHHHH
Confidence            3445677788899999999888787764433


No 314
>PF04267 SoxD:  Sarcosine oxidase, delta subunit family ;  InterPro: IPR006279 These sequences represent the delta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Rhizobium loti (Mesorhizobium loti) and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members share the same function. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate [].  Bacterial sarcosine oxidases have been isolated from over a dozen different organisms and fall into two major classes (1) monomeric form that contains only covalent flavin and (2) heterotetrameric (alpha, beta, gamma, delta) form that contain a covalent and noncovalent flavin, this entry represents the heterotetrameric form.; GO: 0008115 sarcosine oxidase activity, 0046653 tetrahydrofolate metabolic process; PDB: 3AD7_D 1X31_D 1VRQ_D 3AD8_D 3ADA_D 3AD9_D 2GAG_D 2GAH_D.
Probab=42.77  E-value=5.4  Score=31.43  Aligned_cols=31  Identities=26%  Similarity=0.608  Sum_probs=18.2

Q ss_pred             eecCCCCceeeeeCCCcccCCCCCCCCCCCCCCee
Q 026283          199 IRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDII  233 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtI  233 (240)
                      +.||-||+   =+...| .-.|-+.-.|+.+|..+
T Consensus         2 I~CP~CG~---R~~~EF-~y~G~a~i~rP~~~~~~   32 (84)
T PF04267_consen    2 IPCPHCGP---RDESEF-TYGGEAHIARPADPASV   32 (84)
T ss_dssp             EEETTTEE---EEGGGS-EEEEESS----S-GGGS
T ss_pred             ccCCCCCc---cchhhe-ecCcEeccccCCCCCcC
Confidence            67999998   566667 54555566777777664


No 315
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional
Probab=42.50  E-value=13  Score=35.30  Aligned_cols=30  Identities=20%  Similarity=0.244  Sum_probs=20.3

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      -..|+.|++.-+-.......||.||..+.+
T Consensus       244 ~~~C~~c~~~~~~~~~~~~~C~~c~~~~~~  273 (382)
T PRK04338        244 VYYCPKCLYREEVEGLPPEECPVCGGKFGT  273 (382)
T ss_pred             EEECCCCCcEEEecCCCCCCCCCCCCccee
Confidence            467999998654221445679999976544


No 316
>PF14159 CAAD:  CAAD domains of cyanobacterial aminoacyl-tRNA synthetase
Probab=42.33  E-value=62  Score=25.32  Aligned_cols=43  Identities=14%  Similarity=0.215  Sum_probs=28.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHhhhhhc
Q 026283          139 ATIFFLWFALSGWLFRILILATWVLPIAAPLL-------IGTVANNFVIK  181 (240)
Q Consensus       139 ~tl~~~wll~SGWLvn~~l~l~~vlPvaap~l-------i~wWlkRnLIe  181 (240)
                      +...++-.+.+.|+...++-.+=-+|++.+++       ..|+.-|||..
T Consensus        21 ~~~~ii~~iv~l~v~~~vl~aIn~iPll~~llElvGlgyt~wF~~ryLL~   70 (90)
T PF14159_consen   21 TIGAIIAVIVALWVSAAVLDAINSIPLLPGLLELVGLGYTGWFVYRYLLF   70 (90)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCcchHHHHHHHHHHHHhHHHHHHHcC
Confidence            34444455556787777776666677766554       33888888864


No 317
>PRK10246 exonuclease subunit SbcC; Provisional
Probab=42.09  E-value=12  Score=39.69  Aligned_cols=16  Identities=25%  Similarity=0.648  Sum_probs=13.3

Q ss_pred             HhhhhhcCC-CCCCCcc
Q 026283          175 ANNFVIKGA-CPACKRE  190 (240)
Q Consensus       175 lkRnLIeg~-CPvC~~e  190 (240)
                      |...|.+|. |||||..
T Consensus       496 Lr~~L~~GePCPVCGS~  512 (1047)
T PRK10246        496 QRAQLQAGQPCPLCGST  512 (1047)
T ss_pred             HHHhCCCCCCcCCCCcc
Confidence            788888885 9999974


No 318
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=41.99  E-value=14  Score=33.50  Aligned_cols=23  Identities=26%  Similarity=0.681  Sum_probs=14.5

Q ss_pred             CCCCCCcccc----ccccceeecCCCCc
Q 026283          183 ACPACKREFI----GSKSQIIRCAGCGN  206 (240)
Q Consensus       183 ~CPvC~~eFt----G~nnt~~~CpnCGe  206 (240)
                      .||+||....    |- .+-..||+|+.
T Consensus       237 pC~~Cg~~I~~~~~~g-R~ty~Cp~CQ~  263 (269)
T PRK14811        237 PCPRCGTPIEKIVVGG-RGTHFCPQCQP  263 (269)
T ss_pred             CCCcCCCeeEEEEECC-CCcEECCCCcC
Confidence            5888886543    32 34456888864


No 319
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=41.75  E-value=12  Score=28.60  Aligned_cols=23  Identities=30%  Similarity=0.577  Sum_probs=9.3

Q ss_pred             CCCCCCccccccccceeecCCCCce
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .|-+|-.--.  ..+...||+||+.
T Consensus        11 rC~aCf~~t~--~~~k~FCp~CGn~   33 (73)
T PF08772_consen   11 RCHACFKITK--DMTKQFCPKCGNA   33 (73)
T ss_dssp             E-SSS--EES---SS--S-SSS--S
T ss_pred             EccccccCcC--CCCceeCcccCCC
Confidence            3666644332  5678899999985


No 320
>PF02005 TRM:  N2,N2-dimethylguanosine tRNA methyltransferase;  InterPro: IPR002905 This enzyme 2.1.1.32 from EC uses S-adenosyl-L-methionine to methylate tRNA:  S-AdoMet + tRNA = S-adenosyl-L-homocysteine + tRNA containing N2-methylguanine The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs []. The enzyme is found in both eukaryotes and archaea [].; GO: 0003723 RNA binding, 0004809 tRNA (guanine-N2-)-methyltransferase activity, 0008033 tRNA processing; PDB: 2YTZ_B 2DUL_A 2EJU_A 2EJT_A 3AXT_A 3AXS_A.
Probab=41.40  E-value=14  Score=35.35  Aligned_cols=30  Identities=27%  Similarity=0.587  Sum_probs=17.8

Q ss_pred             cCCCCCCCc--cccccccceeecCCCCceeee
Q 026283          181 KGACPACKR--EFIGSKSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       181 eg~CPvC~~--eFtG~nnt~~~CpnCGe~l~v  210 (240)
                      -..|+.|++  ...|+..-...||.||..+.+
T Consensus       240 v~~C~~C~~~~~~~~~~~~~~~c~~cg~~~~~  271 (377)
T PF02005_consen  240 VYYCPSCGYREEVKGLQKLKSKCPECGSKLHI  271 (377)
T ss_dssp             EEEETTT--EECCT-GCC--CEETTT-SCCCE
T ss_pred             EEECCCccccccccCccccCCcCCCCCCccce
Confidence            357999986  344544445899999998766


No 321
>PTZ00410 NAD-dependent SIR2; Provisional
Probab=41.20  E-value=14  Score=35.53  Aligned_cols=33  Identities=21%  Similarity=0.516  Sum_probs=22.1

Q ss_pred             hhhhcCCCCCCCccccc-------cccceeecCCCCceee
Q 026283          177 NFVIKGACPACKREFIG-------SKSQIIRCAGCGNIVW  209 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG-------~nnt~~~CpnCGe~l~  209 (240)
                      -++-+..|..|+..+.-       ..+.+-.||.||.+|.
T Consensus       143 Gsl~~~~C~~C~~~~~~~~~~~~~~~~~vP~C~~CgG~lR  182 (349)
T PTZ00410        143 GSFSAASCIECHTPYDIEQAYLEARSGKVPHCSTCGGIVK  182 (349)
T ss_pred             cCCCeeEeCCCCCCcchhHHHHHhhcCCCCCCCCCCCccC
Confidence            34555789999977641       1234568999997654


No 322
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=40.97  E-value=20  Score=33.58  Aligned_cols=43  Identities=26%  Similarity=0.390  Sum_probs=27.3

Q ss_pred             ccccccceeecCCCCceeeeeCCCcccCCCCCCCCCCCCCCeeee
Q 026283          191 FIGSKSQIIRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDIIDV  235 (240)
Q Consensus       191 FtG~nnt~~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtIDV  235 (240)
                      |.--.+...+||.||...+...=.. | -|-|...-..+|++-||
T Consensus       174 FwLrEGkpqRCpECGqVFKLVr~~~-s-~~dg~dp~~~dpdv~dv  216 (268)
T PTZ00043        174 FRCREGFLYRCGECDQIFMLVRVLY-S-LPDGEDPFPNDPDVDDV  216 (268)
T ss_pred             EEecCCCCccCCCCCcEEEEEEEEe-e-cCCCCCCCCCCCchhhh
Confidence            4445667889999999988755322 2 22233345667777766


No 323
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms. Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. This model identifies both archaeal (aRF1) and eukaryotic (eRF1) of the protein. Also known as translation termination factor 1.
Probab=40.97  E-value=15  Score=35.48  Aligned_cols=32  Identities=22%  Similarity=0.370  Sum_probs=22.0

Q ss_pred             hcCCCCCCCccccccccce-----eecCCCCceeeee
Q 026283          180 IKGACPACKREFIGSKSQI-----IRCAGCGNIVWQP  211 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~-----~~CpnCGe~l~v~  211 (240)
                      ++-.||.|+++-+-+-...     -.||.||..+.+.
T Consensus       319 ~~~rc~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (403)
T TIGR03676       319 VTFKCPNCGYEEEKTVKPEEGDKSEACPKCGSELEIV  355 (403)
T ss_pred             EEEEcCCCCcceeeecccccccccccCcccCcccccc
Confidence            3468999999866433211     3599999987754


No 324
>COG4260 Membrane protease subunit, stomatin/prohibitin family [Amino acid    transport and metabolism]
Probab=40.91  E-value=11  Score=36.30  Aligned_cols=20  Identities=20%  Similarity=0.084  Sum_probs=10.4

Q ss_pred             cchhhhhhhhcccchhHHHH
Q 026283           22 RRRAATVRAFRRSDFDRFAR   41 (240)
Q Consensus        22 ~~~~~~~~af~~~d~d~~a~   41 (240)
                      +-|+--+.+|+=-|--.|..
T Consensus       127 ~lRa~Gtys~kvtDpi~fi~  146 (345)
T COG4260         127 FLRAHGTYSIKVTDPILFIQ  146 (345)
T ss_pred             EEeecceEEEEecCHHHHHH
Confidence            34555555665455444544


No 325
>PRK07219 DNA topoisomerase I; Validated
Probab=40.91  E-value=23  Score=36.97  Aligned_cols=19  Identities=21%  Similarity=0.391  Sum_probs=14.9

Q ss_pred             ceeecCCCCceeeeeCCCc
Q 026283          197 QIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       197 t~~~CpnCGe~l~v~~g~F  215 (240)
                      ....||.||..+.+..|.|
T Consensus       687 ~~~~CP~Cg~~l~~k~gr~  705 (822)
T PRK07219        687 VIGPCPKCGGELAIKQLKY  705 (822)
T ss_pred             ccccCCCCCCeeEEEcCCC
Confidence            3568999998888877665


No 326
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=40.67  E-value=11  Score=34.37  Aligned_cols=30  Identities=23%  Similarity=0.620  Sum_probs=21.4

Q ss_pred             hhhhcCCCCCCCccccccc---cc----eeecCCCCc
Q 026283          177 NFVIKGACPACKREFIGSK---SQ----IIRCAGCGN  206 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG~n---nt----~~~CpnCGe  206 (240)
                      -++-.-.|.-|++.+.+-.   .+    .-+||.||.
T Consensus       118 Gsl~~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~  154 (250)
T COG0846         118 GSLKRVRCSKCGNQYYDEDVIKFIEDGLIPRCPKCGG  154 (250)
T ss_pred             cceeeeEeCCCcCccchhhhhhhcccCCCCcCccCCC
Confidence            3455678999999888332   33    346999999


No 327
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=40.66  E-value=13  Score=23.06  Aligned_cols=9  Identities=56%  Similarity=1.316  Sum_probs=6.4

Q ss_pred             CCCCCCccc
Q 026283          183 ACPACKREF  191 (240)
Q Consensus       183 ~CPvC~~eF  191 (240)
                      +||+|+..+
T Consensus         3 ~CPiC~~~v   11 (26)
T smart00734        3 QCPVCFREV   11 (26)
T ss_pred             cCCCCcCcc
Confidence            578887665


No 328
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism]
Probab=40.38  E-value=11  Score=36.83  Aligned_cols=33  Identities=24%  Similarity=0.390  Sum_probs=25.4

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCceeeeeC
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      ++.-.|..|+.+|.--.- +..||.||-.|-+.=
T Consensus         3 ~~~~rc~~cg~~f~~a~~-~~~c~~cGl~lp~~~   35 (411)
T COG0498           3 YVSLRCLKCGREFSQALL-QGLCPDCGLFLPAEY   35 (411)
T ss_pred             eeEeecCCCCcchhhHHh-hCcCCcCCccccccc
Confidence            456689999999974333 788999999887743


No 329
>smart00350 MCM minichromosome  maintenance proteins.
Probab=40.37  E-value=32  Score=33.54  Aligned_cols=25  Identities=20%  Similarity=0.539  Sum_probs=17.5

Q ss_pred             CCCCCCCcccc-----ccccceeecCC--CCc
Q 026283          182 GACPACKREFI-----GSKSQIIRCAG--CGN  206 (240)
Q Consensus       182 g~CPvC~~eFt-----G~nnt~~~Cpn--CGe  206 (240)
                      -.|..|+.++.     |.......||+  |++
T Consensus        38 f~C~~C~~~~~~~~~~~~~~~p~~C~~~~C~~   69 (509)
T smart00350       38 FTCEKCGATLGPEIQSGRETEPTVCPPRECQS   69 (509)
T ss_pred             EEecCCCCEEeEEecCCcccCCCcCCCCcCCC
Confidence            35999998652     33345668999  986


No 330
>PRK01345 heat shock protein HtpX; Provisional
Probab=40.37  E-value=90  Score=29.03  Aligned_cols=32  Identities=25%  Similarity=0.048  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHh
Q 026283          145 WFALSGWLFRILILATWVLPIAA-PLLIGTVAN  176 (240)
Q Consensus       145 wll~SGWLvn~~l~l~~vlPvaa-p~li~wWlk  176 (240)
                      -+++.||++.+...+++.+++++ +.++.+|.-
T Consensus        16 ~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~~   48 (317)
T PRK01345         16 LFMGVGYLIGGAGGMMIALVIAAGMNLFSYWNS   48 (317)
T ss_pred             HHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHh
Confidence            33444888877654333333332 233444433


No 331
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=40.05  E-value=76  Score=30.58  Aligned_cols=77  Identities=13%  Similarity=0.135  Sum_probs=44.1

Q ss_pred             hHHHHhhhchhHHHHHHHHh----hHHHHHhHHHHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhhhhhhHhHHhhh
Q 026283           37 DRFARRMTSGEAWRDAWRTA----NNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFR  112 (240)
Q Consensus        37 d~~a~~~~~~~a~r~a~r~a----n~~~e~~~fear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~fgi~rR~R~f~  112 (240)
                      |+.-.-..|.+.-++-.-+.    ++--+.+...++....+|+.-++-.....++.+...+++.+|-++..-=..|+...
T Consensus        89 ~gv~~~~~s~~~~n~t~~~i~~~v~~~~~~l~~~v~~~l~~Le~~~~~~~~~~~~~~~~~~~~~~v~~~l~~l~~~~~~~  168 (406)
T PF04906_consen   89 DGVYQLIYSLRNANHTLSGIDNLVSDTTEALNSTVEQHLTRLEEIFAKRTDLLQALQFLQQQAENVVQQLDELPFWRNVS  168 (406)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHhcCcccccCC
Confidence            44433333444444433333    22334455566777778888887666677777777777776666555444565544


Q ss_pred             h
Q 026283          113 M  113 (240)
Q Consensus       113 ~  113 (240)
                      +
T Consensus       169 ~  169 (406)
T PF04906_consen  169 L  169 (406)
T ss_pred             C
Confidence            4


No 332
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=39.97  E-value=4.6e+02  Score=27.44  Aligned_cols=47  Identities=13%  Similarity=0.273  Sum_probs=19.4

Q ss_pred             HHHhhHHHHHhHHHHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhh
Q 026283           53 WRTANNGFEQLVFDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDRE  101 (240)
Q Consensus        53 ~r~an~~~e~~~fear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~  101 (240)
                      .+.+|+.|+....++++.-..+-  .++-+.+++......+.|.+|-..
T Consensus       337 v~~~~~~~~~ip~~v~~qt~~~v--~~ik~~l~~~~~~i~~~a~~i~~~  383 (806)
T PF05478_consen  337 VQEGNSRFNDIPEKVQNQTSDVV--PPIKRDLDSIGKQIRSQAKQIPNQ  383 (806)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhh--HHHHHHHHHHHHHHHHHHHHhHHH
Confidence            33444444444444443222211  134444444444444444444433


No 333
>PF08285 DPM3:  Dolichol-phosphate mannosyltransferase subunit 3 (DPM3);  InterPro: IPR013174 This family corresponds to subunit 3 of dolichol-phosphate mannosyltransferase, an enzyme which generates mannosyl donors for glycosylphosphatidylinositols, N-glycan and protein O- and C-mannosylation. DPM3 is an integral membrane protein and plays a role in stabilising the dolichol-phosphate mannosyl transferase complex [].
Probab=39.52  E-value=67  Score=25.37  Aligned_cols=50  Identities=26%  Similarity=0.315  Sum_probs=30.1

Q ss_pred             HHHHHHHHHHH-HHHH---HHHHHHHHHHHHHHHHHHH-----HHHhhhhhcCCCCCCC
Q 026283          139 ATIFFLWFALS-GWLF---RILILATWVLPIAAPLLIG-----TVANNFVIKGACPACK  188 (240)
Q Consensus       139 ~tl~~~wll~S-GWLv---n~~l~l~~vlPvaap~li~-----wWlkRnLIeg~CPvC~  188 (240)
                      +++..+|+++. +++-   ...--+++.+|+.+.+.||     ...-+-..-..||--.
T Consensus        12 ~~l~~~w~~l~~~~~~~~~~~~~~ii~~lP~~~Lv~fG~Ysl~~lgy~v~tFnDcpeA~   70 (91)
T PF08285_consen   12 LLLSALWLALLLGLLPLPPEPQQEIIPYLPFYALVSFGCYSLFTLGYGVATFNDCPEAA   70 (91)
T ss_pred             HHHHHHHHHHHHccCCCCchhHHHHHHHhhHHHHHHHHHHHHHHHHHhhhccCCCHHHH
Confidence            44555666665 4432   1123577889998888877     4455555566777443


No 334
>PRK14873 primosome assembly protein PriA; Provisional
Probab=39.46  E-value=17  Score=37.31  Aligned_cols=24  Identities=25%  Similarity=0.544  Sum_probs=10.6

Q ss_pred             CCCCCCccccccc-cceeecCCCCc
Q 026283          183 ACPACKREFIGSK-SQIIRCAGCGN  206 (240)
Q Consensus       183 ~CPvC~~eFtG~n-nt~~~CpnCGe  206 (240)
                      .||.|+-.++=-+ ....+|..||-
T Consensus       394 ~C~~C~~~L~~h~~~~~l~Ch~CG~  418 (665)
T PRK14873        394 RCRHCTGPLGLPSAGGTPRCRWCGR  418 (665)
T ss_pred             ECCCCCCceeEecCCCeeECCCCcC
Confidence            4555554444211 22444555554


No 335
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=39.39  E-value=17  Score=33.02  Aligned_cols=10  Identities=20%  Similarity=0.501  Sum_probs=6.0

Q ss_pred             hCCCCchHHH
Q 026283          130 LNTPLGRSFA  139 (240)
Q Consensus       130 ~~T~lG~wL~  139 (240)
                      .-.|+|++.+
T Consensus       176 ~vaGIGNiya  185 (282)
T PRK13945        176 IVAGIGNIYA  185 (282)
T ss_pred             eEeccchhHH
Confidence            3466777654


No 336
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=38.92  E-value=10  Score=40.69  Aligned_cols=30  Identities=23%  Similarity=0.523  Sum_probs=0.0

Q ss_pred             hcCCCCCCCcccc--------ccccceeecCCCCceee
Q 026283          180 IKGACPACKREFI--------GSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       180 Ieg~CPvC~~eFt--------G~nnt~~~CpnCGe~l~  209 (240)
                      +.-.||.||.+=.        |.......||+||....
T Consensus       666 ~~~~Cp~CG~~T~~~~~Cp~C~~~~~~~~C~~C~~~~~  703 (900)
T PF03833_consen  666 FYNRCPECGSHTEPVYVCPDCGIEVEEDECPKCGRETT  703 (900)
T ss_dssp             --------------------------------------
T ss_pred             hhhcCcccCCccccceeccccccccCccccccccccCc
Confidence            4456777776622        33334448888887654


No 337
>smart00355 ZnF_C2H2 zinc finger.
Probab=38.72  E-value=16  Score=19.90  Aligned_cols=12  Identities=33%  Similarity=0.974  Sum_probs=8.9

Q ss_pred             CCCCCCcccccc
Q 026283          183 ACPACKREFIGS  194 (240)
Q Consensus       183 ~CPvC~~eFtG~  194 (240)
                      .|+.|++.|..-
T Consensus         2 ~C~~C~~~f~~~   13 (26)
T smart00355        2 RCPECGKVFKSK   13 (26)
T ss_pred             CCCCCcchhCCH
Confidence            588888888654


No 338
>PRK08173 DNA topoisomerase III; Validated
Probab=38.69  E-value=18  Score=38.11  Aligned_cols=27  Identities=19%  Similarity=0.490  Sum_probs=19.5

Q ss_pred             CCCCCCCccccccccceeecCCCCceee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      +.||.|+.+.. .+.....|.||+-.+|
T Consensus       625 ~~CP~Cg~~~~-~~~~~~~Cs~C~f~~~  651 (862)
T PRK08173        625 TPCPNCGGVVK-ENYRRFACTKCDFSIS  651 (862)
T ss_pred             ccCCccccccc-ccCceeEcCCCCcccc
Confidence            67999998652 1234489999986665


No 339
>PRK02224 chromosome segregation protein; Provisional
Probab=38.67  E-value=17  Score=36.89  Aligned_cols=18  Identities=28%  Similarity=0.778  Sum_probs=13.8

Q ss_pred             hhhhhcCCCCCCCccccc
Q 026283          176 NNFVIKGACPACKREFIG  193 (240)
Q Consensus       176 kRnLIeg~CPvC~~eFtG  193 (240)
                      +..|.++.||+|+.+|.+
T Consensus       446 ~~~l~~~~Cp~C~r~~~~  463 (880)
T PRK02224        446 EALLEAGKCPECGQPVEG  463 (880)
T ss_pred             HHHHhcccCCCCCCcCCC
Confidence            334578999999998854


No 340
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=38.61  E-value=18  Score=35.47  Aligned_cols=28  Identities=32%  Similarity=0.650  Sum_probs=15.4

Q ss_pred             CCCCCccccc-cccceeecCCCCceeeee
Q 026283          184 CPACKREFIG-SKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       184 CPvC~~eFtG-~nnt~~~CpnCGe~l~v~  211 (240)
                      ||.|+-..|= -+....+|..||....++
T Consensus       225 C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~  253 (505)
T TIGR00595       225 CPNCDVSLTYHKKEGKLRCHYCGYQEPIP  253 (505)
T ss_pred             CCCCCCceEEecCCCeEEcCCCcCcCCCC
Confidence            5555544442 133456677777666555


No 341
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=38.16  E-value=21  Score=25.69  Aligned_cols=23  Identities=26%  Similarity=0.547  Sum_probs=15.8

Q ss_pred             CCCCCccc-----cccccceeecCCCCc
Q 026283          184 CPACKREF-----IGSKSQIIRCAGCGN  206 (240)
Q Consensus       184 CPvC~~eF-----tG~nnt~~~CpnCGe  206 (240)
                      |+.|..+-     ..+...+-+||+||.
T Consensus        25 C~~C~~hNGla~~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   25 CSKCFSHNGLAPKEEFEEIQYRCPYCGA   52 (54)
T ss_pred             CcccchhhcccccccCCceEEEcCCCCC
Confidence            77776543     233566889999986


No 342
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=38.01  E-value=26  Score=23.77  Aligned_cols=24  Identities=33%  Similarity=0.829  Sum_probs=16.0

Q ss_pred             cCCCCCCCc--ccccccc----ceeecCCCC
Q 026283          181 KGACPACKR--EFIGSKS----QIIRCAGCG  205 (240)
Q Consensus       181 eg~CPvC~~--eFtG~nn----t~~~CpnCG  205 (240)
                      .+.||+|+-  .|- +++    ---.|-.||
T Consensus         3 ~~pCP~CGG~DrFr-~~d~~g~G~~~C~~Cg   32 (37)
T smart00778        3 HGPCPNCGGSDRFR-FDDKDGRGTWFCSVCG   32 (37)
T ss_pred             ccCCCCCCCccccc-cccCCCCcCEEeCCCC
Confidence            467899986  566 666    445677775


No 343
>PRK10996 thioredoxin 2; Provisional
Probab=38.01  E-value=20  Score=28.68  Aligned_cols=28  Identities=18%  Similarity=0.516  Sum_probs=18.9

Q ss_pred             CCCCCCCccccc---cccceeecCCCCceee
Q 026283          182 GACPACKREFIG---SKSQIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFtG---~nnt~~~CpnCGe~l~  209 (240)
                      ..||.|+-+.--   .---+.+||.||+.+-
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   33 (139)
T PRK10996          3 TVCTSCQAINRLPDERIEDAAKCGRCGHDLF   33 (139)
T ss_pred             EECCCCCCcCCCCCccccCCCcCCCCCCccC
Confidence            469998865422   2234678999998775


No 344
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=37.79  E-value=16  Score=29.19  Aligned_cols=28  Identities=25%  Similarity=0.398  Sum_probs=14.8

Q ss_pred             hcCCCCCCCcccccccccee-ecCCCCce
Q 026283          180 IKGACPACKREFIGSKSQII-RCAGCGNI  207 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~-~CpnCGe~  207 (240)
                      ....|+.|+.+..=++.=.- -||+||..
T Consensus        41 ~~~~C~~Cg~~~~~~~SCk~R~CP~C~~~   69 (111)
T PF14319_consen   41 HRYRCEDCGHEKIVYNSCKNRHCPSCQAK   69 (111)
T ss_pred             ceeecCCCCceEEecCcccCcCCCCCCCh
Confidence            34567777766544332111 46777654


No 345
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=37.65  E-value=29  Score=23.52  Aligned_cols=11  Identities=18%  Similarity=0.416  Sum_probs=6.7

Q ss_pred             cCCCCCCCccc
Q 026283          181 KGACPACKREF  191 (240)
Q Consensus       181 eg~CPvC~~eF  191 (240)
                      .+.||+|+.++
T Consensus        35 ~~~cP~~~~~~   45 (63)
T smart00504       35 HGTDPVTGQPL   45 (63)
T ss_pred             CCCCCCCcCCC
Confidence            45666666655


No 346
>KOG2927 consensus Membrane component of ER protein translocation complex [Intracellular trafficking, secretion, and vesicular transport]
Probab=37.19  E-value=10  Score=36.99  Aligned_cols=34  Identities=26%  Similarity=0.364  Sum_probs=20.7

Q ss_pred             hhhhhhhhchhHHHHHHHhhCCCCchHHHHHHHH
Q 026283          111 FRMDFSRNWPRYRKQLNDFLNTPLGRSFATIFFL  144 (240)
Q Consensus       111 f~~D~~r~wP~yrrql~~F~~T~lG~wL~tl~~~  144 (240)
                      ++.=.=..||++-||-.-++.-|.|+.|+.|+++
T Consensus       202 laivLFPLWP~~mR~gvyY~sig~~gfl~~IlvL  235 (372)
T KOG2927|consen  202 LAIVLFPLWPRRMRQGVYYLSIGAGGFLAFILVL  235 (372)
T ss_pred             HHHHhcccCcHHHhcceeeeecchhHHHHHHHHH
Confidence            3333446777777777666666677766555543


No 347
>TIGR01374 soxD sarcosine oxidase, delta subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form
Probab=37.13  E-value=18  Score=28.56  Aligned_cols=31  Identities=29%  Similarity=0.612  Sum_probs=19.4

Q ss_pred             eecCCCCceeeeeCCCcccCCCCCCCCCCCCCCee
Q 026283          199 IRCAGCGNIVWQPEGDFFSRNGGGKKSTKSDDDII  233 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~F~s~~g~~~~~r~t~pgtI  233 (240)
                      +.||.||+   =+...| +-.|-+.-.|+.+|+..
T Consensus         2 I~CP~CG~---R~~~EF-~y~G~A~~~rP~~~~~~   32 (84)
T TIGR01374         2 IPCPYCGP---RPEEEF-TYGGDAHIVRPADPAAA   32 (84)
T ss_pred             ccCCCCCC---ccHhhE-eccceecccCCCCCCcC
Confidence            67999993   566677 54555554566555543


No 348
>PRK14894 glycyl-tRNA synthetase; Provisional
Probab=37.07  E-value=20  Score=36.66  Aligned_cols=25  Identities=24%  Similarity=0.557  Sum_probs=17.1

Q ss_pred             cCCCCCCCccccccccceeecCCCCc
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      --.|+.|+..|-.=. -.++||+||+
T Consensus        88 mV~CkkCk~ryRaD~-LiikCP~CGs  112 (539)
T PRK14894         88 LVDCRDCKMRWRADH-IQGVCPNCGS  112 (539)
T ss_pred             eeECCCCCccccCcc-ceeeCCCCCC
Confidence            346889998774322 2367999995


No 349
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=37.06  E-value=19  Score=38.49  Aligned_cols=30  Identities=27%  Similarity=0.448  Sum_probs=23.8

Q ss_pred             CCCCCCcccc-------ccccceeecCCC---CceeeeeC
Q 026283          183 ACPACKREFI-------GSKSQIIRCAGC---GNIVWQPE  212 (240)
Q Consensus       183 ~CPvC~~eFt-------G~nnt~~~CpnC---Ge~l~v~~  212 (240)
                      .||.|+..|.       .||+..--||.|   |..+.+..
T Consensus       254 ~c~~~g~~~~~~~p~~FSfN~p~G~Cp~C~G~G~~~~~d~  293 (943)
T PRK00349        254 ACPVCGFSIPELEPRLFSFNSPYGACPTCDGLGVKLEFDP  293 (943)
T ss_pred             cCcccCCCcCcCChhhcCCCCccCCCCcCCCceeEeecCH
Confidence            6999999877       789999999999   65544433


No 350
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=36.99  E-value=10  Score=22.94  Aligned_cols=10  Identities=40%  Similarity=1.165  Sum_probs=7.8

Q ss_pred             CCCCCCcccc
Q 026283          183 ACPACKREFI  192 (240)
Q Consensus       183 ~CPvC~~eFt  192 (240)
                      .||.|++.|.
T Consensus        16 ~C~~C~k~F~   25 (26)
T PF13465_consen   16 KCPYCGKSFS   25 (26)
T ss_dssp             EESSSSEEES
T ss_pred             CCCCCcCeeC
Confidence            5888888774


No 351
>PRK00420 hypothetical protein; Validated
Probab=36.61  E-value=19  Score=29.65  Aligned_cols=24  Identities=25%  Similarity=0.585  Sum_probs=18.9

Q ss_pred             cccccceeecCCCCceeee-eCCCc
Q 026283          192 IGSKSQIIRCAGCGNIVWQ-PEGDF  215 (240)
Q Consensus       192 tG~nnt~~~CpnCGe~l~v-~~g~F  215 (240)
                      -|..-....||.||-+|.- .+|+.
T Consensus        17 ~Ga~ml~~~CP~Cg~pLf~lk~g~~   41 (112)
T PRK00420         17 KGAKMLSKHCPVCGLPLFELKDGEV   41 (112)
T ss_pred             hHHHHccCCCCCCCCcceecCCCce
Confidence            3555566899999999998 77776


No 352
>KOG1307 consensus K+-dependent Ca2+/Na+ exchanger NCKX1 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms]
Probab=36.49  E-value=56  Score=33.63  Aligned_cols=57  Identities=23%  Similarity=0.333  Sum_probs=41.7

Q ss_pred             hhCCCCchHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcCCCCCC
Q 026283          129 FLNTPLGRSFATIFFLWF------ALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPAC  187 (240)
Q Consensus       129 F~~T~lG~wL~tl~~~wl------l~SGWLvn~~l~l~~vlPvaap~li~wWlkRnLIeg~CPvC  187 (240)
                      -++.+|=|.+++||+..+      +++.|-.|=++++++++--.+|+.+---+.-+++  .||+|
T Consensus       525 vsS~GL~csi~lLf~ml~v~v~~ia~~rWrMnK~lG~~m~llY~~Fl~~svmlE~~v~--tcp~~  587 (588)
T KOG1307|consen  525 VSSNGLVCSIGLLFAMLIVLVLGIALSRWRMNKILGFLMILLYFVFLIISVMLETDVL--TCPLS  587 (588)
T ss_pred             ecCCceehHHHHHHHHHHHHHHHHHHHhhhcccchhHHHHHHHHHHHHhhhheeccee--cccCC
Confidence            356688888877665333      3349999999988888888888888776666655  47776


No 353
>COG4965 TadB Flp pilus assembly protein TadB [Intracellular trafficking and secretion]
Probab=36.25  E-value=3.3e+02  Score=26.16  Aligned_cols=18  Identities=22%  Similarity=0.080  Sum_probs=13.6

Q ss_pred             hhHhHHhhhhhhhhhchh
Q 026283          104 ISVRWRSFRMDFSRNWPR  121 (240)
Q Consensus       104 i~rR~R~f~~D~~r~wP~  121 (240)
                      ...|.+.+.+++.+-|-+
T Consensus        53 ~~~r~~~~~~~l~~~~~~   70 (309)
T COG4965          53 LSSRRLSAQDSLKRLDRK   70 (309)
T ss_pred             chhhcccccchhhhHhhh
Confidence            677888889888776543


No 354
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=36.12  E-value=19  Score=32.82  Aligned_cols=31  Identities=23%  Similarity=0.532  Sum_probs=18.9

Q ss_pred             hhhcCCCCCCCcccccc-----------ccceeecCCCCceee
Q 026283          178 FVIKGACPACKREFIGS-----------KSQIIRCAGCGNIVW  209 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~-----------nnt~~~CpnCGe~l~  209 (240)
                      |+-+..|..|++++---           ....-.|| ||.+|.
T Consensus       134 ~l~~~~C~~C~~~~~~~~~~~~~~~~~~~~~~P~C~-Cgg~lr  175 (271)
T PTZ00409        134 SVFEARCCTCRKTIQLNKIMLQKTSHFMHQLPPECP-CGGIFK  175 (271)
T ss_pred             CcCcceeCCCCCCcccCHHHHhhhhhhccCCCCCCC-CCCccc
Confidence            44567899998776410           11234799 986543


No 355
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=35.97  E-value=18  Score=33.83  Aligned_cols=26  Identities=27%  Similarity=0.499  Sum_probs=18.8

Q ss_pred             CCCCCCCcccccccccee-----------ecCCCCce
Q 026283          182 GACPACKREFIGSKSQII-----------RCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~-----------~CpnCGe~  207 (240)
                      -.||.|+..=.-|.+.|+           +|.+||..
T Consensus       259 ~~C~~C~~~~~~~~q~QtrsaDEpmT~f~~C~~Cg~~  295 (299)
T TIGR01385       259 FTCGKCKQKKCTYYQLQTRSADEPMTTFVTCEECGNR  295 (299)
T ss_pred             ccCCCCCCccceEEEecccCCCCCCeEEEEcCCCCCe
Confidence            479999987776665543           58888863


No 356
>PF09925 DUF2157:  Predicted membrane protein (DUF2157);  InterPro: IPR018677 This family of various hypothetical prokaryotic proteins has no known function.
Probab=35.91  E-value=2.3e+02  Score=22.93  Aligned_cols=45  Identities=16%  Similarity=0.196  Sum_probs=31.8

Q ss_pred             CCchHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHhh
Q 026283          133 PLGRSFATIFFLWFALSGW--LFRILILATWVLPIAAPLLIGTVANN  177 (240)
Q Consensus       133 ~lG~wL~tl~~~wll~SGW--Lvn~~l~l~~vlPvaap~li~wWlkR  177 (240)
                      -+|-.+..+.+++|...-|  +=...-+.+.+.++++..+.++++.+
T Consensus        38 ~lGall~~~gii~fvA~nW~~i~~~~k~~~~~~~~~~~~~~~~~~~~   84 (145)
T PF09925_consen   38 YLGALLLGLGIILFVAANWDDIPRLAKLGLLLALLLLSYVGGFWLWR   84 (145)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3788888889999999988  33444455566667767777777643


No 357
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=35.86  E-value=19  Score=27.11  Aligned_cols=19  Identities=32%  Similarity=0.842  Sum_probs=11.2

Q ss_pred             ceeecCCCCcee-eeeCCCc
Q 026283          197 QIIRCAGCGNIV-WQPEGDF  215 (240)
Q Consensus       197 t~~~CpnCGe~l-~v~~g~F  215 (240)
                      +...||.||.++ |.++..|
T Consensus         5 ~~v~CP~C~k~~~w~~~~~~   24 (62)
T PRK00418          5 ITVNCPTCGKPVEWGEISPF   24 (62)
T ss_pred             ccccCCCCCCcccccCCCCc
Confidence            346788888765 3444443


No 358
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=35.83  E-value=13  Score=35.03  Aligned_cols=29  Identities=24%  Similarity=0.415  Sum_probs=20.5

Q ss_pred             CCCCCCccccc--cccceeecCCCCceeeee
Q 026283          183 ACPACKREFIG--SKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       183 ~CPvC~~eFtG--~nnt~~~CpnCGe~l~v~  211 (240)
                      .||.|+....-  +....-.||+||--....
T Consensus        40 kc~~C~~~~~~~~l~~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         40 QCENCYGLNYKKFLKSKMNICEQCGYHLKMS   70 (296)
T ss_pred             ECCCccchhhHHHHHHcCCCCCCCCCCcCCC
Confidence            69999987654  334446899999866543


No 359
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=35.13  E-value=24  Score=30.94  Aligned_cols=22  Identities=18%  Similarity=0.465  Sum_probs=15.6

Q ss_pred             CCCCCCccccccccceeecCCCCce
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      .|..||+--.   .=.-.||+||..
T Consensus       356 ~c~~cg~~~~---~~~~~c~~c~~~  377 (389)
T PRK11788        356 RCRNCGFTAR---TLYWHCPSCKAW  377 (389)
T ss_pred             ECCCCCCCCc---cceeECcCCCCc
Confidence            4888876543   346789999964


No 360
>PF08507 COPI_assoc:  COPI associated protein;  InterPro: IPR013714 Proteins in this family co-localise with COPI vesicle coat proteins []. In yeast it is a Golgi membrane protein involved in vesicular trafficking, interacting with TVP18 []. 
Probab=35.09  E-value=1.5e+02  Score=23.91  Aligned_cols=38  Identities=34%  Similarity=0.611  Sum_probs=26.1

Q ss_pred             chhHHHHHHHhhCCCCchHHHHHHHHHHHHHHHHHHHHH
Q 026283          119 WPRYRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILI  157 (240)
Q Consensus       119 wP~yrrql~~F~~T~lG~wL~tl~~~wll~SGWLvn~~l  157 (240)
                      +|..++.. .|+.+.+|+-+.-+|+.-+..+.-++..++
T Consensus        54 ~~~i~~~~-~FL~~~~GRGlfyif~G~l~~~~~~~~~i~   91 (136)
T PF08507_consen   54 WPFIRKYF-GFLYSYIGRGLFYIFLGTLCLGQSILSIII   91 (136)
T ss_pred             cHHHHHhH-hHHHhHHHHHHHHHHHHHHHHhhHHHHHHH
Confidence            33355555 999999999998888876666643333333


No 361
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=35.08  E-value=22  Score=30.94  Aligned_cols=28  Identities=18%  Similarity=0.488  Sum_probs=13.6

Q ss_pred             hhcCCCCCCCccccccccc---eeecCCCCc
Q 026283          179 VIKGACPACKREFIGSKSQ---IIRCAGCGN  206 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt---~~~CpnCGe  206 (240)
                      |---.|+.|+-+|+-.+++   ...||-|..
T Consensus       132 l~l~~C~~C~~~fv~~~~~~~~~~~Cp~C~~  162 (175)
T PF05280_consen  132 LQLAPCRRCGGHFVTHAHDPRHSFVCPFCQP  162 (175)
T ss_dssp             EEEEE-TTT--EEEEESS--SS----TT---
T ss_pred             ccccCCCCCCCCeECcCCCCCcCcCCCCCCC
Confidence            3444799999999998776   488999984


No 362
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=34.97  E-value=21  Score=38.60  Aligned_cols=26  Identities=27%  Similarity=0.585  Sum_probs=21.7

Q ss_pred             cCCCCCCCccc-------cccccceeecCCCCc
Q 026283          181 KGACPACKREF-------IGSKSQIIRCAGCGN  206 (240)
Q Consensus       181 eg~CPvC~~eF-------tG~nnt~~~CpnCGe  206 (240)
                      ..+||+|++.+       ..||+..--||.|.-
T Consensus       245 ~~acp~~g~~~~eleprlFSFNsP~GaCp~C~G  277 (935)
T COG0178         245 NFACPVCGFSIPELEPRLFSFNSPFGACPTCDG  277 (935)
T ss_pred             ccCCCccCcccCCCCcccccCCCCCCCCCcCCC
Confidence            35899999876       678999999999953


No 363
>PF13994 PgaD:  PgaD-like protein
Probab=34.86  E-value=1.6e+02  Score=24.11  Aligned_cols=28  Identities=25%  Similarity=0.249  Sum_probs=16.9

Q ss_pred             hhhhhchhHHHHHHHhhCCCCchHHHHHHH
Q 026283          114 DFSRNWPRYRKQLNDFLNTPLGRSFATIFF  143 (240)
Q Consensus       114 D~~r~wP~yrrql~~F~~T~lG~wL~tl~~  143 (240)
                      |-.|..|+++|-++.+.  ++-.|+..+.+
T Consensus         4 ~~~r~~~~~~r~~~~~l--T~~~W~~~~yL   31 (138)
T PF13994_consen    4 TEPRLLPRHQRLIDYFL--TLLFWGGFIYL   31 (138)
T ss_pred             ccccccchHHHHHHHHH--HHHHHHHHHHH
Confidence            55788888888885554  23445444433


No 364
>PRK08382 putative monovalent cation/H+ antiporter subunit E; Reviewed
Probab=34.83  E-value=93  Score=27.76  Aligned_cols=57  Identities=12%  Similarity=0.057  Sum_probs=29.9

Q ss_pred             HHHhhhhhcCCCCCCCccccccccceeecCCCCceeeeeCCCcccCCCC---CCCCCCCCCCeeeeeccc
Q 026283          173 TVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGDFFSRNGG---GKKSTKSDDDIIDVDFEE  239 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~F~s~~g~---~~~~r~t~pgtIDVe~e~  239 (240)
                      +|+=..++..+.-|+..-++ .+-      + -..+.++-.-= +.-|.   +++-.+ -|||+-||+++
T Consensus       103 ~~l~~eivkANi~Va~~VL~-~~i------~-Pgiv~v~~~l~-~~~~~~~LAnsITL-TPGTltvdvs~  162 (201)
T PRK08382        103 IIMAFRLLESNLKVAKHVIF-MDI------N-PGIVKIKTDLH-SDTGITILANSITL-TPGTLTLDVVK  162 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHhC-CCC------C-CcEEEEeccCC-ChHHHHHHHHHHhc-CCCeEEEEeec
Confidence            55555666777777776665 221      1 23456655431 21122   244444 47888777763


No 365
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=34.61  E-value=23  Score=28.52  Aligned_cols=34  Identities=24%  Similarity=0.411  Sum_probs=25.9

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCceeeeeC
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      ++-|+|-+|+-.=--..+.+..|-+||.....+.
T Consensus        33 va~daCeiC~~~GY~q~g~~lvC~~C~~~~~~~~   66 (102)
T PF10080_consen   33 VAFDACEICGPKGYYQEGDQLVCKNCGVRFNLPT   66 (102)
T ss_pred             EEEEeccccCCCceEEECCEEEEecCCCEEehhh
Confidence            3458999995543335677899999999887776


No 366
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=34.59  E-value=19  Score=39.15  Aligned_cols=40  Identities=23%  Similarity=0.424  Sum_probs=27.6

Q ss_pred             HHhhhhhcCCCCCCCccccccc----cceeecCCCCceeeeeCC
Q 026283          174 VANNFVIKGACPACKREFIGSK----SQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       174 WlkRnLIeg~CPvC~~eFtG~n----nt~~~CpnCGe~l~v~~g  213 (240)
                      |..-.-..+.|..|+..|+-+.    +.+--|-+||.++=..=.
T Consensus       453 WqpDDEaSdtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~CS  496 (1374)
T PTZ00303        453 WQKDDESSDSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCI  496 (1374)
T ss_pred             CCCCcccCCcccCcCCcccccccccccccccccCCccccCcccc
Confidence            3333334567999999998652    456669999998765443


No 367
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=34.52  E-value=11  Score=37.10  Aligned_cols=30  Identities=33%  Similarity=0.635  Sum_probs=20.7

Q ss_pred             CCCCCCCcc--ccccccceeecCCCCceeeeeCC
Q 026283          182 GACPACKRE--FIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       182 g~CPvC~~e--FtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      -+|-.|...  ..-...-..+||+||.  ++..|
T Consensus       247 TAC~rC~t~y~le~A~~~~wrCpkCGg--~ikKG  278 (403)
T COG1379         247 TACSRCYTRYSLEEAKSLRWRCPKCGG--KIKKG  278 (403)
T ss_pred             HHHHHhhhccCcchhhhhcccCccccc--chhhh
Confidence            468888733  3455556689999999  55554


No 368
>PTZ00408 NAD-dependent deacetylase; Provisional
Probab=34.41  E-value=16  Score=32.73  Aligned_cols=30  Identities=27%  Similarity=0.371  Sum_probs=19.8

Q ss_pred             hhhhcCCCCCCCccccc---cccceeecCCCCc
Q 026283          177 NFVIKGACPACKREFIG---SKSQIIRCAGCGN  206 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG---~nnt~~~CpnCGe  206 (240)
                      -++-+..|..|++.|.-   +..+.-.||.||.
T Consensus       113 G~~~~~~C~~C~~~~~~~~~~~~~~p~C~~Cg~  145 (242)
T PTZ00408        113 GELLKVRCTATGHVFDWTEDVVHGSSRCKCCGC  145 (242)
T ss_pred             CccceEEECCCCcccCchhhhhcCCCccccCCC
Confidence            44555789999987642   1223467999983


No 369
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=34.24  E-value=25  Score=23.67  Aligned_cols=25  Identities=24%  Similarity=0.638  Sum_probs=10.8

Q ss_pred             CCCC--CCccccccccce---eecCCCCce
Q 026283          183 ACPA--CKREFIGSKSQI---IRCAGCGNI  207 (240)
Q Consensus       183 ~CPv--C~~eFtG~nnt~---~~CpnCGe~  207 (240)
                      .||.  |++-+..-....   .+|+.||..
T Consensus        20 ~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~   49 (64)
T PF01485_consen   20 WCPNPDCEYIIEKDDGCNSPIVTCPSCGTE   49 (64)
T ss_dssp             --TTSST---ECS-SSTTS--CCTTSCCSE
T ss_pred             CCCCCCCcccEEecCCCCCCeeECCCCCCc
Confidence            6766  776665443332   567777653


No 370
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=34.21  E-value=38  Score=21.54  Aligned_cols=18  Identities=39%  Similarity=0.713  Sum_probs=14.9

Q ss_pred             cceeecCCCCceeeeeCC
Q 026283          196 SQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       196 nt~~~CpnCGe~l~v~~g  213 (240)
                      ....+|..||++|.+-++
T Consensus         5 ~~~ykC~~Cgniv~v~~~   22 (34)
T TIGR00319         5 GQVYKCEVCGNIVEVLHA   22 (34)
T ss_pred             CcEEEcCCCCcEEEEEEC
Confidence            567899999999987754


No 371
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=33.93  E-value=20  Score=37.29  Aligned_cols=16  Identities=25%  Similarity=0.646  Sum_probs=12.1

Q ss_pred             hcCCCCCCCccccccc
Q 026283          180 IKGACPACKREFIGSK  195 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~n  195 (240)
                      ..+.|||||.+..+..
T Consensus       456 ~~~~CPvCg~~l~~~~  471 (908)
T COG0419         456 AGEKCPVCGQELPEEH  471 (908)
T ss_pred             CCCCCCCCCCCCCcHH
Confidence            4689999998776543


No 372
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.86  E-value=20  Score=28.48  Aligned_cols=12  Identities=42%  Similarity=1.182  Sum_probs=5.5

Q ss_pred             hcCCCCCCCccc
Q 026283          180 IKGACPACKREF  191 (240)
Q Consensus       180 Ieg~CPvC~~eF  191 (240)
                      ..|.||.||-|+
T Consensus        40 l~g~CPnCGGel   51 (84)
T COG3813          40 LHGLCPNCGGEL   51 (84)
T ss_pred             hcCcCCCCCchh
Confidence            344444444444


No 373
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=33.78  E-value=28  Score=25.63  Aligned_cols=12  Identities=33%  Similarity=0.717  Sum_probs=5.9

Q ss_pred             eecCCCCceeee
Q 026283          199 IRCAGCGNIVWQ  210 (240)
Q Consensus       199 ~~CpnCGe~l~v  210 (240)
                      ..||.||.++..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            468888887777


No 374
>PRK09401 reverse gyrase; Reviewed
Probab=33.71  E-value=18  Score=39.42  Aligned_cols=26  Identities=23%  Similarity=0.627  Sum_probs=20.4

Q ss_pred             hcCCCCCCCccccccccceeecCCCCcee
Q 026283          180 IKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      +...|+.||++|+.--   -.||.||..+
T Consensus       677 ~~k~c~~~g~~f~~~~---~~~~~c~~~~  702 (1176)
T PRK09401        677 TIKRCRDCGYQFTDES---DKCPRCGSTN  702 (1176)
T ss_pred             eecccccccccccccc---cccccccccc
Confidence            4467999999999853   3999999543


No 375
>COG3898 Uncharacterized membrane-bound protein [Function unknown]
Probab=33.67  E-value=1.1e+02  Score=31.21  Aligned_cols=33  Identities=12%  Similarity=0.182  Sum_probs=21.6

Q ss_pred             HHHHHHHH--HHHHHHHHHHHHHHHHHHhhhhhcC
Q 026283          150 GWLFRILI--LATWVLPIAAPLLIGTVANNFVIKG  182 (240)
Q Consensus       150 GWLvn~~l--~l~~vlPvaap~li~wWlkRnLIeg  182 (240)
                      ||.++.-+  ...+++-+++-++|-||+-+.+++-
T Consensus        34 G~~~emslm~Aa~~iva~vaav~llwwlv~~iw~s   68 (531)
T COG3898          34 GQQYEMSLMVAASIIVALVAAVLLLWWLVRSIWES   68 (531)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            88887664  3333344444666779998888864


No 376
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=33.66  E-value=25  Score=33.35  Aligned_cols=10  Identities=40%  Similarity=0.836  Sum_probs=5.5

Q ss_pred             CCcccccccc
Q 026283           14 PKTTLHIGRR   23 (240)
Q Consensus        14 ~~~~~~~~~~   23 (240)
                      |+..+|++--
T Consensus        10 ~Ng~lHlGH~   19 (391)
T PF09334_consen   10 PNGDLHLGHL   19 (391)
T ss_dssp             TSSS-BHHHH
T ss_pred             CCCCCCCChh
Confidence            5667777543


No 377
>KOG1729 consensus FYVE finger containing protein [General function prediction only]
Probab=33.63  E-value=9.6  Score=35.68  Aligned_cols=31  Identities=26%  Similarity=0.569  Sum_probs=25.3

Q ss_pred             cCCCCCCCccccccccceeecCCCCceeeee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      ...|++|+....++.+..--|-+||-++-.+
T Consensus       168 a~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~~  198 (288)
T KOG1729|consen  168 ATECMVCGCTEFTLSERRHHCRNCGDIVCAP  198 (288)
T ss_pred             ceecccCCCccccHHHHHHHHHhcchHhhhh
Confidence            3479999995666778888899999998773


No 378
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=33.48  E-value=23  Score=30.21  Aligned_cols=28  Identities=29%  Similarity=0.699  Sum_probs=20.6

Q ss_pred             CCCCCCccccccc-cceeecCCCCceeee
Q 026283          183 ACPACKREFIGSK-SQIIRCAGCGNIVWQ  210 (240)
Q Consensus       183 ~CPvC~~eFtG~n-nt~~~CpnCGe~l~v  210 (240)
                      +|-.||..|---. .--.=||+||.-..+
T Consensus         3 ~Ct~Cg~~f~dgs~eil~GCP~CGg~kF~   31 (131)
T PF09845_consen    3 QCTKCGRVFEDGSKEILSGCPECGGNKFQ   31 (131)
T ss_pred             ccCcCCCCcCCCcHHHHccCcccCCcceE
Confidence            6999999996333 445569999976554


No 379
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=33.44  E-value=13  Score=38.73  Aligned_cols=25  Identities=32%  Similarity=0.804  Sum_probs=20.1

Q ss_pred             CCCCCCccccccccceeecCCCCcee
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      +|-+|+.+|+.++... -|.|||.+.
T Consensus       903 ~cmacq~pf~afrrrh-hcrncggif  927 (990)
T KOG1819|consen  903 QCMACQMPFNAFRRRH-HCRNCGGIF  927 (990)
T ss_pred             hhhhccCcHHHHHHhh-hhcccCcee
Confidence            5679999999988654 599999765


No 380
>PF11833 DUF3353:  Protein of unknown function (DUF3353);  InterPro: IPR021788  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. 
Probab=33.27  E-value=3.3e+02  Score=24.04  Aligned_cols=72  Identities=18%  Similarity=0.193  Sum_probs=40.9

Q ss_pred             HHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhhhh--------hhHhHHhhhh--------hhhhhchhHHHHHHHh
Q 026283           66 DAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFA--------ISVRWRSFRM--------DFSRNWPRYRKQLNDF  129 (240)
Q Consensus        66 ear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~fg--------i~rR~R~f~~--------D~~r~wP~yrrql~~F  129 (240)
                      |.+++-+++-.+|.=-.+.-+..+.|-|.-  +=+.+.        +..++|..-.        .-...-|.|-+++...
T Consensus         8 EIq~Arn~ll~~y~gd~~~~~~IEaAYD~I--LM~rL~~Rq~Gki~v~~~ir~ad~~~~~~~~~~~~~~~p~wl~~~~~~   85 (194)
T PF11833_consen    8 EIQAARNRLLAQYAGDEKSREAIEAAYDAI--LMERLRQRQKGKIKVPERIRYADREEPKPPNPKPSNPSPPWLQRLLPS   85 (194)
T ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHHHHHH--HHHHHHHHHcCCCCccHHHHHhhhccccccCCCCCCccchHHHhcccc
Confidence            445556677778876666666666666532  112222        3344443222        2335677888877555


Q ss_pred             hCCCCchHHH
Q 026283          130 LNTPLGRSFA  139 (240)
Q Consensus       130 ~~T~lG~wL~  139 (240)
                      .++|=+.-+.
T Consensus        86 ~~~P~~~~l~   95 (194)
T PF11833_consen   86 FDTPSSQDLL   95 (194)
T ss_pred             eeCCCcchHH
Confidence            6677776553


No 381
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=33.20  E-value=14  Score=20.86  Aligned_cols=11  Identities=36%  Similarity=1.114  Sum_probs=7.6

Q ss_pred             CCCCCCccccc
Q 026283          183 ACPACKREFIG  193 (240)
Q Consensus       183 ~CPvC~~eFtG  193 (240)
                      .||.|+..|.-
T Consensus         2 ~C~~C~~~f~~   12 (23)
T PF00096_consen    2 KCPICGKSFSS   12 (23)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCCCCCccCC
Confidence            47888877753


No 382
>PF09972 DUF2207:  Predicted membrane protein (DUF2207);  InterPro: IPR018702 This domain has no known function.
Probab=32.82  E-value=2.1e+02  Score=26.28  Aligned_cols=12  Identities=17%  Similarity=0.207  Sum_probs=5.7

Q ss_pred             HHHHhHHHHHHH
Q 026283           59 GFEQLVFDAKKT   70 (240)
Q Consensus        59 ~~e~~~fear~~   70 (240)
                      ..|+..+++=..
T Consensus       330 ~~E~~ll~~l~~  341 (511)
T PF09972_consen  330 PYERALLDWLFN  341 (511)
T ss_pred             HHHHHHHHHHhc
Confidence            455555544333


No 383
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=32.81  E-value=30  Score=24.64  Aligned_cols=19  Identities=21%  Similarity=0.576  Sum_probs=15.3

Q ss_pred             ccccceeecCCCCceeeee
Q 026283          193 GSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       193 G~nnt~~~CpnCGe~l~v~  211 (240)
                      .-|.+..||-.|.|++...
T Consensus        26 ~k~~~klrCGaCs~vl~~s   44 (46)
T PF11331_consen   26 KKNQQKLRCGACSEVLSFS   44 (46)
T ss_pred             ccceeEEeCCCCceeEEEe
Confidence            4457899999999998753


No 384
>PLN03121 nucleic acid binding protein; Provisional
Probab=32.70  E-value=42  Score=31.09  Aligned_cols=41  Identities=27%  Similarity=0.244  Sum_probs=33.1

Q ss_pred             HHHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhhhhhhHhHHhhh
Q 026283           65 FDAKKTAERIDRQYSVSRRLNSAARTAAVRARELDREFAISVRWRSFR  112 (240)
Q Consensus        65 fear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~fgi~rR~R~f~  112 (240)
                      .+|=.-|..+|+++.||.       +|....-+||+++||..++-+-.
T Consensus       135 kda~~KAkafDE~h~lss-------~a~a~v~~~d~~iglt~k~~~g~  175 (243)
T PLN03121        135 KDALSKAKAFDESHQVSA-------TAAAKVAELSKRIGLTDKIFAGM  175 (243)
T ss_pred             HHHHHHHHHHHHhcCccH-------hhhhhhhhhhhhccchhhhhhhH
Confidence            346566889999999995       66778889999999999986533


No 385
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=32.61  E-value=38  Score=24.89  Aligned_cols=29  Identities=24%  Similarity=0.698  Sum_probs=19.1

Q ss_pred             CCCCCCc-cccccccceeecCCCCceeeee
Q 026283          183 ACPACKR-EFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       183 ~CPvC~~-eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      .||-||- .|-.--.....|--||-..|+.
T Consensus        21 ~CPrCG~gvfmA~H~dR~~CGkCgyTe~~~   50 (51)
T COG1998          21 FCPRCGPGVFMADHKDRWACGKCGYTEFKK   50 (51)
T ss_pred             cCCCCCCcchhhhcCceeEeccccceEeec
Confidence            5777775 5666666677777777665543


No 386
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=32.60  E-value=23  Score=21.87  Aligned_cols=24  Identities=21%  Similarity=0.504  Sum_probs=11.0

Q ss_pred             CCCCCCcccccccc---ceeecCCCCc
Q 026283          183 ACPACKREFIGSKS---QIIRCAGCGN  206 (240)
Q Consensus       183 ~CPvC~~eFtG~nn---t~~~CpnCGe  206 (240)
                      .||.|+....-...   .-..||.|.+
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRCQK   29 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTTCC
T ss_pred             cCccCCCcceEeEecCCCCeECcCCcC
Confidence            57788777633222   3355777765


No 387
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=32.45  E-value=26  Score=26.96  Aligned_cols=17  Identities=18%  Similarity=0.435  Sum_probs=12.8

Q ss_pred             eecCCCCceeeeeCCCc
Q 026283          199 IRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g~F  215 (240)
                      ..||.|+.+|...+|+|
T Consensus         2 ~~CP~C~~~L~~~~~~~   18 (70)
T PF07191_consen    2 NTCPKCQQELEWQGGHY   18 (70)
T ss_dssp             -B-SSS-SBEEEETTEE
T ss_pred             CcCCCCCCccEEeCCEE
Confidence            57999999999999887


No 388
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=32.43  E-value=34  Score=26.26  Aligned_cols=32  Identities=25%  Similarity=0.507  Sum_probs=15.5

Q ss_pred             cCCCCCCCcc-ccc------cccceeecCCCCceeeeeC
Q 026283          181 KGACPACKRE-FIG------SKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       181 eg~CPvC~~e-FtG------~nnt~~~CpnCGe~l~v~~  212 (240)
                      .-+||.|+++ -+.      .+.-.+.|-+||+.-..+=
T Consensus        22 ~F~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~~~~i   60 (81)
T PF05129_consen   22 VFDCPFCNHEKSVSVKIDKKEGIGILSCRVCGESFQTKI   60 (81)
T ss_dssp             ----TTT--SS-EEEEEETTTTEEEEEESSS--EEEEE-
T ss_pred             eEcCCcCCCCCeEEEEEEccCCEEEEEecCCCCeEEEcc
Confidence            4579999944 222      2345789999998876663


No 389
>PF11290 DUF3090:  Protein of unknown function (DUF3090);  InterPro: IPR021441  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=32.40  E-value=20  Score=31.75  Aligned_cols=15  Identities=40%  Similarity=0.860  Sum_probs=10.5

Q ss_pred             ecCCCCceeeeeCCCc
Q 026283          200 RCAGCGNIVWQPEGDF  215 (240)
Q Consensus       200 ~CpnCGe~l~v~~g~F  215 (240)
                      .||.||++|- +.|||
T Consensus       156 ~CPlCg~PlD-P~GH~  170 (171)
T PF11290_consen  156 PCPLCGEPLD-PEGHI  170 (171)
T ss_pred             CCCCCCCCCC-CCCCc
Confidence            5888888864 45765


No 390
>TIGR01597 PYST-B Plasmodium yoelii subtelomeric family PYST-B. This model represents a paralogous family of Plasmodium yoelii genes preferentially located in the subtelomeric regions of the chromosomes. There are no obvious homologs to these genes in any other organism.
Probab=32.36  E-value=1.1e+02  Score=28.73  Aligned_cols=47  Identities=11%  Similarity=0.184  Sum_probs=23.6

Q ss_pred             HHHHHHHhhCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 026283          122 YRKQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVA  175 (240)
Q Consensus       122 yrrql~~F~~T~lG~wL~tl~~~wll~SGWLvn~~l~l~~vlPvaap~li~wWl  175 (240)
                      +++....+.   +.+.+.+..++.++.|||+-    ++++++|.+..+-..||-
T Consensus       193 lkK~~~kli---~~~l~~i~~~~~i~isG~~~----l~~l~i~~~~si~~~~~~  239 (255)
T TIGR01597       193 LKKLVKKLI---VRCLTFIVIVCSILVSGPVY----LLALIIPSLISIYWSIWR  239 (255)
T ss_pred             HHHHHHHHH---HHHHHHHHHHHHHhhcchHH----HHHHHHHHHHHHHHHHHH
Confidence            444444444   33333333344556679972    334556666455555654


No 391
>PHA02768 hypothetical protein; Provisional
Probab=32.18  E-value=22  Score=26.11  Aligned_cols=28  Identities=29%  Similarity=0.651  Sum_probs=20.3

Q ss_pred             hcCCCCCCCcccccccc---------ceeecCCCCce
Q 026283          180 IKGACPACKREFIGSKS---------QIIRCAGCGNI  207 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~nn---------t~~~CpnCGe~  207 (240)
                      .--.||.|+..|+-..+         ..-.|.+||..
T Consensus         4 ~~y~C~~CGK~Fs~~~~L~~H~r~H~k~~kc~~C~k~   40 (55)
T PHA02768          4 LGYECPICGEIYIKRKSMITHLRKHNTNLKLSNCKRI   40 (55)
T ss_pred             cccCcchhCCeeccHHHHHHHHHhcCCcccCCcccce
Confidence            34589999999975432         35689999875


No 392
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=32.08  E-value=34  Score=25.23  Aligned_cols=20  Identities=15%  Similarity=0.356  Sum_probs=13.0

Q ss_pred             CCCCCCCccccccccceeecCC
Q 026283          182 GACPACKREFIGSKSQIIRCAG  203 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~Cpn  203 (240)
                      ..|++|+.++..  +.-...|+
T Consensus        79 ~~C~vC~k~l~~--~~f~~~p~   98 (109)
T PF10367_consen   79 TKCSVCGKPLGN--SVFVVFPC   98 (109)
T ss_pred             CCccCcCCcCCC--ceEEEeCC
Confidence            569999988844  44444444


No 393
>smart00837 DPBB_1 Rare lipoprotein A (RlpA)-like double-psi beta-barrel. Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen.
Probab=32.02  E-value=21  Score=27.64  Aligned_cols=9  Identities=22%  Similarity=0.582  Sum_probs=6.8

Q ss_pred             CCCeeeeec
Q 026283          229 DDDIIDVDF  237 (240)
Q Consensus       229 ~pgtIDVe~  237 (240)
                      ..|+|+|++
T Consensus        79 ~~Gvi~v~y   87 (87)
T smart00837       79 KAGIVPVKY   87 (87)
T ss_pred             cCCEEeeEC
Confidence            349999885


No 394
>PRK01741 cell division protein ZipA; Provisional
Probab=31.85  E-value=34  Score=33.01  Aligned_cols=25  Identities=16%  Similarity=0.287  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Q 026283          153 FRILILATWVLPIAAPLLIGTVANN  177 (240)
Q Consensus       153 vn~~l~l~~vlPvaap~li~wWlkR  177 (240)
                      +|.|||++-++-++++++.|-|.+|
T Consensus         3 Ln~iliILg~lal~~Lv~hgiWsnR   27 (332)
T PRK01741          3 LNTILIILGILALVALVAHGIWSNR   27 (332)
T ss_pred             ceehHHHHHHHHHHHHHHhhhhhhh
Confidence            4677888888888889999999887


No 395
>PF06364 DUF1068:  Protein of unknown function (DUF1068);  InterPro: IPR010471 This family consists of several hypothetical plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Probab=31.58  E-value=41  Score=30.03  Aligned_cols=38  Identities=24%  Similarity=0.460  Sum_probs=26.0

Q ss_pred             HHHHHHHHHHHhhhhh---cCCCCCCCccccccccceeecCCCCceeeeeCCC
Q 026283          165 IAAPLLIGTVANNFVI---KGACPACKREFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       165 vaap~li~wWlkRnLI---eg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      |++|.+ -|=++.++.   ...||.|-          |-|| .-..|.++.|-
T Consensus        23 ivGP~L-YWh~~~~~~~~s~~sCppC~----------CDCs-~~~ll~ip~gl   63 (176)
T PF06364_consen   23 IVGPPL-YWHLSEGLAAVSSSSCPPCD----------CDCS-SQPLLSIPPGL   63 (176)
T ss_pred             eeCchH-HHHHHHhhhcccCCCCCCCC----------CCCC-CHHHHHhcccc
Confidence            334433 355555544   58999996          8888 78888999774


No 396
>PF04674 Phi_1:  Phosphate-induced protein 1 conserved region;  InterPro: IPR006766 This entry represents a family of conserved plant proteins. A conserved region in these proteins was identified in a phosphate-induced protein of unknown function [].
Probab=31.49  E-value=29  Score=32.56  Aligned_cols=34  Identities=18%  Similarity=0.375  Sum_probs=24.3

Q ss_pred             hhhhhcCCCC-CCCccccccc-------------cceeecCC-CCceee
Q 026283          176 NNFVIKGACP-ACKREFIGSK-------------SQIIRCAG-CGNIVW  209 (240)
Q Consensus       176 kRnLIeg~CP-vC~~eFtG~n-------------nt~~~Cpn-CGe~l~  209 (240)
                      ....|||-|- .|+++-....             |...|||+ |.=|.-
T Consensus       114 ~DV~v~gFC~~~CG~H~~~~~~~~~~~~~YawVGns~~qCPg~CAwPf~  162 (273)
T PF04674_consen  114 ADVAVEGFCMSRCGFHGSTFPSSVGKRLPYAWVGNSETQCPGQCAWPFH  162 (273)
T ss_pred             ccceecccccccccCCcCCcccccccceeEEEecCccCCCCCCCCCCCc
Confidence            4556899997 6999855543             46689997 964433


No 397
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=31.43  E-value=28  Score=20.96  Aligned_cols=11  Identities=27%  Similarity=0.899  Sum_probs=7.3

Q ss_pred             CCCCCCccccc
Q 026283          183 ACPACKREFIG  193 (240)
Q Consensus       183 ~CPvC~~eFtG  193 (240)
                      .|+.|+..+.+
T Consensus         1 ~C~~C~~~i~~   11 (39)
T smart00132        1 KCAGCGKPIRG   11 (39)
T ss_pred             CccccCCcccC
Confidence            36777776665


No 398
>PTZ00396 Casein kinase II subunit beta; Provisional
Probab=31.28  E-value=31  Score=31.92  Aligned_cols=34  Identities=18%  Similarity=0.521  Sum_probs=24.9

Q ss_pred             hhcCCCC--CCCcc---------ccccccceeecCCCCceeeeeC
Q 026283          179 VIKGACP--ACKRE---------FIGSKSQIIRCAGCGNIVWQPE  212 (240)
Q Consensus       179 LIeg~CP--vC~~e---------FtG~nnt~~~CpnCGe~l~v~~  212 (240)
                      -+-|.||  -|+.+         -.|.....+.||+|.++-.-+.
T Consensus       118 g~FG~CPRv~C~~q~~LPvGlSd~~g~~~VKlyCP~C~DvY~p~s  162 (251)
T PTZ00396        118 GKFGHCPRVLCEGQNVLPIGLSDVLKTSRVKVYCPRCQEVYHPKK  162 (251)
T ss_pred             CCCCCCCCccCCCCcccccccCCCcCcCceeEeCCCchhhcCCCC
Confidence            4568999  57744         4566777889999999875443


No 399
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1. Alternative names include eRF1, SUP45, omnipotent suppressor protein 1.
Probab=30.97  E-value=26  Score=33.80  Aligned_cols=31  Identities=16%  Similarity=0.446  Sum_probs=20.0

Q ss_pred             hcCCCCCCCcccccc-----ccceeecCCCCceeee
Q 026283          180 IKGACPACKREFIGS-----KSQIIRCAGCGNIVWQ  210 (240)
Q Consensus       180 Ieg~CPvC~~eFtG~-----nnt~~~CpnCGe~l~v  210 (240)
                      ++-.||.|+++-...     +.....||+||..+.+
T Consensus       323 ~~~r~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~  358 (409)
T TIGR00108       323 VTYKCAECGEVIEKTVRELKDKKFAICPACGQEMDV  358 (409)
T ss_pred             EEEEcCCCCceeecccccccccccccCcccCccccc
Confidence            456899999841111     1234589999988743


No 400
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=30.80  E-value=29  Score=25.50  Aligned_cols=12  Identities=8%  Similarity=-0.056  Sum_probs=9.6

Q ss_pred             eeecCCCCceee
Q 026283          198 IIRCAGCGNIVW  209 (240)
Q Consensus       198 ~~~CpnCGe~l~  209 (240)
                      ...||+|||...
T Consensus        27 ~~~c~~cg~~~~   38 (60)
T PRK01110         27 LSVDKTTGEYHL   38 (60)
T ss_pred             eeEcCCCCceec
Confidence            578999999764


No 401
>PRK11032 hypothetical protein; Provisional
Probab=30.56  E-value=26  Score=30.35  Aligned_cols=26  Identities=19%  Similarity=0.469  Sum_probs=19.0

Q ss_pred             CCCCCCCccccccc-cceeecCCCCce
Q 026283          182 GACPACKREFIGSK-SQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~n-nt~~~CpnCGe~  207 (240)
                      ..|-.|+++..=.. ....-||.||..
T Consensus       125 LvC~~Cg~~~~~~~p~~i~pCp~C~~~  151 (160)
T PRK11032        125 LVCEKCHHHLAFYTPEVLPLCPKCGHD  151 (160)
T ss_pred             EEecCCCCEEEecCCCcCCCCCCCCCC
Confidence            35889998876555 456689999864


No 402
>PRK00635 excinuclease ABC subunit A; Provisional
Probab=30.53  E-value=28  Score=39.98  Aligned_cols=31  Identities=19%  Similarity=0.438  Sum_probs=24.1

Q ss_pred             hcCCCCCCCcccc-------ccccceeecCCC---Cceeee
Q 026283          180 IKGACPACKREFI-------GSKSQIIRCAGC---GNIVWQ  210 (240)
Q Consensus       180 Ieg~CPvC~~eFt-------G~nnt~~~CpnC---Ge~l~v  210 (240)
                      ..-.||.|++.|.       .||+..--||.|   |....+
T Consensus       243 ~~~~cp~~~~~~~~~~p~~FSfNsp~GaCp~C~GlG~~~~~  283 (1809)
T PRK00635        243 TQATIPETQQTYTPLTPQLFSPHSLEDRCPQCQGSGIFISI  283 (1809)
T ss_pred             ccccCCccCcccCcCChhhcCCCCccccCCCCCCccccccc
Confidence            4567999998765       788889999999   655444


No 403
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=30.42  E-value=44  Score=26.85  Aligned_cols=22  Identities=14%  Similarity=0.255  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 026283          151 WLFRILILATWVLPIAAPLLIG  172 (240)
Q Consensus       151 WLvn~~l~l~~vlPvaap~li~  172 (240)
                      |+|-++|++++++-|+++..++
T Consensus         2 W~l~~iii~~i~l~~~~~~~~~   23 (130)
T PF12273_consen    2 WVLFAIIIVAILLFLFLFYCHN   23 (130)
T ss_pred             eeeHHHHHHHHHHHHHHHHHHH
Confidence            6555555444444455555544


No 404
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=30.40  E-value=21  Score=26.60  Aligned_cols=18  Identities=39%  Similarity=1.006  Sum_probs=15.9

Q ss_pred             eeecCCCCceeeeeCCCc
Q 026283          198 IIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g~F  215 (240)
                      .+.|.+||-.++.+.-.|
T Consensus        31 kikC~gCg~~imlpR~~f   48 (57)
T PF06107_consen   31 KIKCLGCGRQIMLPRSKF   48 (57)
T ss_pred             EEEECCCCCEEEEeHHHH
Confidence            367999999999998887


No 405
>PRK06599 DNA topoisomerase I; Validated
Probab=30.19  E-value=41  Score=34.24  Aligned_cols=16  Identities=25%  Similarity=0.810  Sum_probs=12.3

Q ss_pred             ecCCCCceeeeeCCCc
Q 026283          200 RCAGCGNIVWQPEGDF  215 (240)
Q Consensus       200 ~CpnCGe~l~v~~g~F  215 (240)
                      .||.||..+.+.+|.+
T Consensus       639 ~Cp~C~~~~~~kkgk~  654 (675)
T PRK06599        639 KCPKCGGPLVLKKGRY  654 (675)
T ss_pred             CCCCCCCeeEEEeCCC
Confidence            7888888877777664


No 406
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=30.04  E-value=49  Score=21.12  Aligned_cols=18  Identities=33%  Similarity=0.566  Sum_probs=14.3

Q ss_pred             cceeecCCCCceeeeeCC
Q 026283          196 SQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       196 nt~~~CpnCGe~l~v~~g  213 (240)
                      +...+|..||+++.+-++
T Consensus         2 ~~~ykC~~CGniv~v~~~   19 (34)
T cd00974           2 LEVYKCEICGNIVEVLNV   19 (34)
T ss_pred             CcEEEcCCCCcEEEEEEC
Confidence            346789999999987764


No 407
>PRK14282 chaperone protein DnaJ; Provisional
Probab=29.98  E-value=49  Score=31.11  Aligned_cols=13  Identities=31%  Similarity=0.636  Sum_probs=8.9

Q ss_pred             ccccceeecCCCC
Q 026283          193 GSKSQIIRCAGCG  205 (240)
Q Consensus       193 G~nnt~~~CpnCG  205 (240)
                      |+-.++..|+.|+
T Consensus       190 G~~~~~~~C~~C~  202 (369)
T PRK14282        190 GVFVSERTCERCG  202 (369)
T ss_pred             cceEEEEECCCCC
Confidence            5666677777774


No 408
>PRK12722 transcriptional activator FlhC; Provisional
Probab=29.61  E-value=54  Score=29.22  Aligned_cols=40  Identities=20%  Similarity=0.409  Sum_probs=28.8

Q ss_pred             HHHHHHHHHhhhhhcCCCCCCCccccccccce---eecCCCCc
Q 026283          167 APLLIGTVANNFVIKGACPACKREFIGSKSQI---IRCAGCGN  206 (240)
Q Consensus       167 ap~li~wWlkRnLIeg~CPvC~~eFtG~nnt~---~~CpnCGe  206 (240)
                      |+-|.+..-...|---.|.-|+-+|+.-++..   ..||-|.-
T Consensus       120 Aw~LvRf~~s~~L~l~~C~~Cgg~fv~~~~e~~~~f~CplC~~  162 (187)
T PRK12722        120 AWTLVRFVDSGMLQLSSCNCCGGHFVTHAHDPVGSFVCGLCQP  162 (187)
T ss_pred             HHHHHHHHhcCcEeeccCCCCCCCeeccccccCCCCcCCCCCC
Confidence            34445555555566667999999999777654   67999986


No 409
>PF05473 Herpes_UL45:  UL45 protein;  InterPro: IPR008646 This family consists several UL45 proteins and homologues found in the herpes simplex virus family. The herpes simplex virus UL45 gene encodes an 18 kDa virion envelope protein whose function remains unknown. It has been suggested that the 18 kDa UL45 gene product is required for efficient growth in the central nervous system at low doses and may play an important role under the conditions of a naturally acquired infection []. The Equine herpesvirus 1 UL45 protein represents a type II membrane glycoprotein which has found to be non-essential for EHV-1 growth in vitro but deletion reduces the viruses' replication efficiency [].
Probab=29.60  E-value=1.2e+02  Score=26.67  Aligned_cols=15  Identities=27%  Similarity=0.837  Sum_probs=10.6

Q ss_pred             CCCCCCccccccccc
Q 026283          183 ACPACKREFIGSKSQ  197 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt  197 (240)
                      .|+.|-.+-+||+|.
T Consensus        81 ~~~~CP~~Wi~~~~~   95 (200)
T PF05473_consen   81 GCGPCPKGWIGYNNS   95 (200)
T ss_pred             cCCCCCccceeeCCE
Confidence            567777777777753


No 410
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=29.59  E-value=21  Score=31.73  Aligned_cols=28  Identities=18%  Similarity=0.449  Sum_probs=19.9

Q ss_pred             cCCCCCCCcccccccccee-ecCCCCcee
Q 026283          181 KGACPACKREFIGSKSQII-RCAGCGNIV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~-~CpnCGe~l  208 (240)
                      .-.|.+|+..|+=.+..|. =||.||..+
T Consensus         6 ~rKCKvCg~~F~P~~s~q~vCSpeCa~a~   34 (189)
T PF05766_consen    6 RRKCKVCGEWFVPARSNQKVCSPECAIAL   34 (189)
T ss_pred             CCcCcccCCccccCCCceeeeCHHHHhHH
Confidence            4579999999995544444 468898544


No 411
>PRK03072 heat shock protein HtpX; Provisional
Probab=29.42  E-value=1.9e+02  Score=26.43  Aligned_cols=36  Identities=14%  Similarity=-0.094  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHhhhhh
Q 026283          144 LWFALSGWLFRILILATWVLPIA-APLLIGTVANNFVI  180 (240)
Q Consensus       144 ~wll~SGWLvn~~l~l~~vlPva-ap~li~wWlkRnLI  180 (240)
                      +-+++.||++ +..++++.+.++ +..++.+|.-..++
T Consensus        19 ~~~~~~g~~~-~~~~~~~~~~~~~~~~~~~~~~s~~~~   55 (288)
T PRK03072         19 ALIVFIGALF-GRTGLGIAVLIAVGMNAYVYWNSDKLA   55 (288)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHhHHHH
Confidence            3344448888 444333333332 23335555444443


No 412
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=29.41  E-value=62  Score=28.42  Aligned_cols=33  Identities=18%  Similarity=0.335  Sum_probs=25.0

Q ss_pred             CCCCCCCcccccccc----ceeecCCCCceeeeeCCC
Q 026283          182 GACPACKREFIGSKS----QIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       182 g~CPvC~~eFtG~nn----t~~~CpnCGe~l~v~~g~  214 (240)
                      -.||.|+++=|=+..    -...|-.||..=.|..-.
T Consensus        99 V~C~~C~~pdT~l~k~~~~~~l~C~aCGa~~~v~~~~  135 (201)
T PRK12336         99 VICSECGLPDTRLVKEDRVLMLRCDACGAHRPVKKRK  135 (201)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCCCccccccc
Confidence            369999998887753    356999999877666544


No 413
>PLN00193 expansin-A; Provisional
Probab=29.35  E-value=31  Score=31.87  Aligned_cols=10  Identities=30%  Similarity=0.481  Sum_probs=7.9

Q ss_pred             CCCeeeeecc
Q 026283          229 DDDIIDVDFE  238 (240)
Q Consensus       229 ~pgtIDVe~e  238 (240)
                      ..|+|||++.
T Consensus       145 ~~Giv~V~yr  154 (256)
T PLN00193        145 RGGIVPVLFQ  154 (256)
T ss_pred             cCCeEeEEEE
Confidence            4599999875


No 414
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=29.32  E-value=31  Score=22.18  Aligned_cols=21  Identities=29%  Similarity=0.755  Sum_probs=12.2

Q ss_pred             CCCCCCCccccccccceeecCCCCcee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      ..|-||++      ...-.||.||..+
T Consensus         3 ~~C~vC~~------~~kY~Cp~C~~~~   23 (30)
T PF04438_consen    3 KLCSVCGN------PAKYRCPRCGARY   23 (30)
T ss_dssp             EEETSSSS------EESEE-TTT--EE
T ss_pred             CCCccCcC------CCEEECCCcCCce
Confidence            35778876      3466899998763


No 415
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=29.29  E-value=32  Score=25.36  Aligned_cols=28  Identities=18%  Similarity=0.468  Sum_probs=13.2

Q ss_pred             CCCCCCCccccccccceeecCCCCceee
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      .+|..||+=.--.+...--|+.||++|.
T Consensus        19 ~NCl~CGkIiC~~Eg~~~pC~fCg~~l~   46 (57)
T PF06221_consen   19 PNCLNCGKIICEQEGPLGPCPFCGTPLL   46 (57)
T ss_pred             ccccccChhhcccccCcCcCCCCCCccc
Confidence            4455555443333332444556655553


No 416
>PLN03024 Putative EG45-like domain containing protein 1; Provisional
Probab=29.09  E-value=22  Score=29.44  Aligned_cols=10  Identities=30%  Similarity=0.577  Sum_probs=7.8

Q ss_pred             CCCeeeeecc
Q 026283          229 DDDIIDVDFE  238 (240)
Q Consensus       229 ~pgtIDVe~e  238 (240)
                      ..|+|+|+++
T Consensus       115 ~aG~v~V~y~  124 (125)
T PLN03024        115 VAGIINIDYI  124 (125)
T ss_pred             cCCEEEEEEe
Confidence            4589999885


No 417
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=28.88  E-value=31  Score=26.25  Aligned_cols=33  Identities=24%  Similarity=0.541  Sum_probs=25.9

Q ss_pred             hhhhcCCCCCCCccccccccceeecCCCCceee
Q 026283          177 NFVIKGACPACKREFIGSKSQIIRCAGCGNIVW  209 (240)
Q Consensus       177 RnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~  209 (240)
                      -+.+.--|--|+.|-+=-...++||-.||--+.
T Consensus        16 ~~~miYiCgdC~~en~lk~~D~irCReCG~RIl   48 (62)
T KOG3507|consen   16 TATMIYICGDCGQENTLKRGDVIRCRECGYRIL   48 (62)
T ss_pred             cccEEEEeccccccccccCCCcEehhhcchHHH
Confidence            344555688999999988889999999996543


No 418
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=28.86  E-value=23  Score=36.60  Aligned_cols=31  Identities=29%  Similarity=0.647  Sum_probs=24.3

Q ss_pred             CCCCCCccccccc-----cceeecCCCCceeeeeCC
Q 026283          183 ACPACKREFIGSK-----SQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       183 ~CPvC~~eFtG~n-----nt~~~CpnCGe~l~v~~g  213 (240)
                      -||.|..|+.--+     -+-+-||+||=.|+..+.
T Consensus       120 ~C~~C~~ey~~p~~rr~h~~~~~C~~Cgp~l~l~~~  155 (711)
T TIGR00143       120 LCPDCAKEYKDPLDRRFHAQPIACPRCGPQLNFVSR  155 (711)
T ss_pred             CCHHHHHHhcCCccccCCCCCccCCCCCcEEEEEeC
Confidence            5999999975432     367889999999988654


No 419
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=28.83  E-value=76  Score=29.19  Aligned_cols=16  Identities=6%  Similarity=-0.141  Sum_probs=11.5

Q ss_pred             HHHHhhhhhcCCCCCCC
Q 026283          172 GTVANNFVIKGACPACK  188 (240)
Q Consensus       172 ~wWlkRnLIeg~CPvC~  188 (240)
                      +.|+==||-|| |++..
T Consensus       182 ~fWlfPNLfeD-~Gf~e  197 (232)
T TIGR00869       182 GIWIFPNLFAD-VGFLD  197 (232)
T ss_pred             Ceeeecchhcc-cCcce
Confidence            46777788888 87654


No 420
>PF12648 TcpE:  TcpE family
Probab=28.81  E-value=66  Score=25.08  Aligned_cols=21  Identities=14%  Similarity=0.126  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHhhhhhcCCCC
Q 026283          165 IAAPLLIGTVANNFVIKGACP  185 (240)
Q Consensus       165 vaap~li~wWlkRnLIeg~CP  185 (240)
                      ++.|.++.|++.+.=.+|+=|
T Consensus        64 ~~iP~~l~~~~~~~k~DGK~~   84 (108)
T PF12648_consen   64 FVIPYGLAWFLSKKKPDGKKP   84 (108)
T ss_pred             HhHHHHHHHHHhhcCcCCCCH
Confidence            346888999998887777543


No 421
>PF11872 DUF3392:  Protein of unknown function (DUF3392);  InterPro: IPR021813  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length. 
Probab=28.70  E-value=1.3e+02  Score=24.70  Aligned_cols=16  Identities=25%  Similarity=0.385  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHhhh
Q 026283          163 LPIAAPLLIGTVANNF  178 (240)
Q Consensus       163 lPvaap~li~wWlkRn  178 (240)
                      .-++.++++|.|++||
T Consensus        91 ~vl~~F~~iG~lAqR~  106 (106)
T PF11872_consen   91 VVLLSFILIGVLAQRN  106 (106)
T ss_pred             HHHHHHHHHHHHhccC
Confidence            3344577799999987


No 422
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=28.60  E-value=33  Score=22.48  Aligned_cols=15  Identities=33%  Similarity=0.725  Sum_probs=9.3

Q ss_pred             eecCCCCceeeeeCC
Q 026283          199 IRCAGCGNIVWQPEG  213 (240)
Q Consensus       199 ~~CpnCGe~l~v~~g  213 (240)
                      ..||.||..-.+.+|
T Consensus         3 ~~Cp~Cg~~~~~~~g   17 (47)
T PF14690_consen    3 PRCPHCGSPSVHRHG   17 (47)
T ss_pred             ccCCCcCCCceECCc
Confidence            568888866544444


No 423
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=28.27  E-value=40  Score=22.87  Aligned_cols=18  Identities=33%  Similarity=0.693  Sum_probs=11.1

Q ss_pred             cceeecCCCCceeeeeCC
Q 026283          196 SQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       196 nt~~~CpnCGe~l~v~~g  213 (240)
                      .+.-.|.-||++|.+-++
T Consensus         4 ~~~YkC~~CGniVev~~~   21 (36)
T PF06397_consen    4 GEFYKCEHCGNIVEVVHD   21 (36)
T ss_dssp             TEEEE-TTT--EEEEEE-
T ss_pred             ccEEEccCCCCEEEEEEC
Confidence            456789999999988765


No 424
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=28.20  E-value=21  Score=33.18  Aligned_cols=29  Identities=21%  Similarity=0.636  Sum_probs=20.4

Q ss_pred             CCCCCCccccc--cccceeecCCCCceeeee
Q 026283          183 ACPACKREFIG--SKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       183 ~CPvC~~eFtG--~nnt~~~CpnCGe~l~v~  211 (240)
                      .||.|+....-  +....-.||.||.-....
T Consensus        29 ~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~   59 (292)
T PRK05654         29 KCPSCGQVLYRKELEANLNVCPKCGHHMRIS   59 (292)
T ss_pred             ECCCccchhhHHHHHhcCCCCCCCCCCeeCC
Confidence            69999976543  222245899999887764


No 425
>KOG1088 consensus Uncharacterized conserved protein [Function unknown]
Probab=28.14  E-value=36  Score=28.88  Aligned_cols=17  Identities=18%  Similarity=0.349  Sum_probs=13.3

Q ss_pred             eeecCCCCceeeeeCCC
Q 026283          198 IIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~g~  214 (240)
                      +.+||+||.+--+.+|-
T Consensus        98 ~l~CpetG~vfpI~~GI  114 (124)
T KOG1088|consen   98 ELVCPETGRVFPISDGI  114 (124)
T ss_pred             eEecCCCCcEeecccCC
Confidence            57888888888887773


No 426
>PLN03120 nucleic acid binding protein; Provisional
Probab=28.14  E-value=69  Score=29.91  Aligned_cols=30  Identities=23%  Similarity=0.421  Sum_probs=24.0

Q ss_pred             HHHHHHhhhhhhhhhHhHHHHHHHHHHHHH
Q 026283           67 AKKTAERIDRQYSVSRRLNSAARTAAVRAR   96 (240)
Q Consensus        67 ar~~a~r~D~~Y~vs~r~a~aa~~a~e~A~   96 (240)
                      ++..+..+|.+|.||.|...|.-.+...+-
T Consensus       165 v~~~~k~vDeky~vs~kt~sa~~~~~~~~~  194 (260)
T PLN03120        165 VNEKVKEVDQKYQVSEKTKSALAAAEQKVS  194 (260)
T ss_pred             HHHHHHhhhhhhchhHHHHHHHHHHHHHHH
Confidence            446788999999999999888877766543


No 427
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=27.93  E-value=34  Score=28.67  Aligned_cols=29  Identities=21%  Similarity=0.493  Sum_probs=21.4

Q ss_pred             CCCCCCCcccccccc----ceeecCCCCceeee
Q 026283          182 GACPACKREFIGSKS----QIIRCAGCGNIVWQ  210 (240)
Q Consensus       182 g~CPvC~~eFtG~nn----t~~~CpnCGe~l~v  210 (240)
                      -.||.|+.+=|=+..    ....|-.||..=.|
T Consensus        98 VlC~~C~sPdT~l~k~~r~~~l~C~ACGa~~~v  130 (133)
T TIGR00311        98 VICRECNRPDTRIIKEGRVSLLKCEACGAKAPL  130 (133)
T ss_pred             EECCCCCCCCcEEEEeCCeEEEecccCCCCCcc
Confidence            359999998887753    34699999975433


No 428
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=27.76  E-value=37  Score=26.15  Aligned_cols=13  Identities=31%  Similarity=0.634  Sum_probs=11.9

Q ss_pred             ecCCCCceeeeeC
Q 026283          200 RCAGCGNIVWQPE  212 (240)
Q Consensus       200 ~CpnCGe~l~v~~  212 (240)
                      .|.+||-|+..+.
T Consensus         2 ~CQSCGMPl~~~~   14 (81)
T PF12674_consen    2 FCQSCGMPLSKDE   14 (81)
T ss_pred             cCCcCcCccCCcc
Confidence            5999999999888


No 429
>PF09567 RE_MamI:  MamI restriction endonuclease;  InterPro: IPR019067 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This entry includes the MamI restriction endonuclease which recognises and cleaves GATNN^NNATC. ; GO: 0003677 DNA binding, 0009036 Type II site-specific deoxyribonuclease activity, 0009307 DNA restriction-modification system
Probab=27.70  E-value=26  Score=33.42  Aligned_cols=22  Identities=27%  Similarity=0.735  Sum_probs=16.0

Q ss_pred             CCCCCCCccccccccceeecCCCCc
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe  206 (240)
                      |.|-.||.+-..   -+.-|||||-
T Consensus        83 ~~C~~CGa~V~~---~e~~Cp~C~S  104 (314)
T PF09567_consen   83 GKCNNCGANVSR---LEESCPNCGS  104 (314)
T ss_pred             hhhccccceeee---hhhcCCCCCc
Confidence            678888866544   4678999984


No 430
>PF05077 DUF678:  Protein of unknown function (DUF678);  InterPro: IPR007769 This family contains poxvirus proteins belonging to the A19 family. The proteins are of unknown function.
Probab=27.65  E-value=35  Score=26.73  Aligned_cols=17  Identities=24%  Similarity=0.655  Sum_probs=13.0

Q ss_pred             ccceeecCCCCceeeee
Q 026283          195 KSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       195 nnt~~~CpnCGe~l~v~  211 (240)
                      ++....|..||-.|.-=
T Consensus        54 ~~~tLsCsACGS~L~~L   70 (74)
T PF05077_consen   54 KGNTLSCSACGSELRPL   70 (74)
T ss_pred             CCCeEeehhccccceec
Confidence            36778999999887643


No 431
>TIGR03518 ABC_perm_GldF gliding motility-associated ABC transporter permease protein GldF. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldF is believed to be a ABC transporter permease protein (along with ATP-binding subunit, GldA and a sunstrate-binding subunit, GldG) and is linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldF abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=27.64  E-value=2e+02  Score=25.15  Aligned_cols=28  Identities=25%  Similarity=0.573  Sum_probs=22.9

Q ss_pred             hchhHHHHHHHhhCCCCchHHHHHHHHH
Q 026283          118 NWPRYRKQLNDFLNTPLGRSFATIFFLW  145 (240)
Q Consensus       118 ~wP~yrrql~~F~~T~lG~wL~tl~~~w  145 (240)
                      +++-+||++.++..||++-.+.+++.+.
T Consensus         1 ~~~i~~kEl~~~f~sp~~yv~~~~~~~~   28 (240)
T TIGR03518         1 MKAIFKKEFNSFFSSPIGYLVIAVFLLA   28 (240)
T ss_pred             CHHHHHHHHHHHhcCHHHHHHHHHHHHH
Confidence            3577999999999999999877766543


No 432
>PHA02893 hypothetical protein; Provisional
Probab=27.63  E-value=25  Score=28.35  Aligned_cols=15  Identities=27%  Similarity=0.786  Sum_probs=12.0

Q ss_pred             cceeecCCCCceeee
Q 026283          196 SQIIRCAGCGNIVWQ  210 (240)
Q Consensus       196 nt~~~CpnCGe~l~v  210 (240)
                      +..+.|..||-.|.-
T Consensus        67 ~~tL~CaACGS~L~~   81 (88)
T PHA02893         67 NSNIKCIACGSSLCH   81 (88)
T ss_pred             CCceeehhhchhhhh
Confidence            677889999988753


No 433
>PRK13415 flagella biosynthesis protein FliZ; Provisional
Probab=27.46  E-value=85  Score=28.77  Aligned_cols=28  Identities=7%  Similarity=0.127  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q 026283          152 LFRILILATWVLPIAAPLLIGTVANNFVI  180 (240)
Q Consensus       152 Lvn~~l~l~~vlPvaap~li~wWlkRnLI  180 (240)
                      ++..+..+++|+-++ +++.+|+.+|+-.
T Consensus        68 l~qmi~aL~~VI~Li-y~l~rwL~rR~~~   95 (219)
T PRK13415         68 FVKLIGATLFVIFLI-YALVKWLNKRNRL   95 (219)
T ss_pred             HHHHHHHHHHHHHHH-HHHHHHHHHhccc
Confidence            555555555553333 5556788887643


No 434
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=27.43  E-value=34  Score=29.09  Aligned_cols=26  Identities=23%  Similarity=0.597  Sum_probs=16.4

Q ss_pred             CCCCCCCccccccc-cceeecCCCCce
Q 026283          182 GACPACKREFIGSK-SQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~n-nt~~~CpnCGe~  207 (240)
                      -.|-.||++..=.. ....-||.||..
T Consensus       113 l~C~~Cg~~~~~~~~~~l~~Cp~C~~~  139 (146)
T PF07295_consen  113 LVCENCGHEVELTHPERLPPCPKCGHT  139 (146)
T ss_pred             EecccCCCEEEecCCCcCCCCCCCCCC
Confidence            35888887643322 345578888864


No 435
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=27.07  E-value=36  Score=28.68  Aligned_cols=29  Identities=21%  Similarity=0.471  Sum_probs=22.0

Q ss_pred             CCCCCCCcccccccc----ceeecCCCCceeee
Q 026283          182 GACPACKREFIGSKS----QIIRCAGCGNIVWQ  210 (240)
Q Consensus       182 g~CPvC~~eFtG~nn----t~~~CpnCGe~l~v  210 (240)
                      -.||.|+.+=|=+..    -...|-.||..=.|
T Consensus       103 VlC~~C~spdT~l~k~~r~~~l~C~ACGa~~~V  135 (138)
T PRK03988        103 VICPECGSPDTKLIKEGRIWVLKCEACGAETPV  135 (138)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCCCCcC
Confidence            469999998887753    46789999975433


No 436
>TIGR02205 septum_zipA cell division protein ZipA. This model represents the full length of bacterial cell division protein ZipA. The N-terminal hydrophobic stretch is an uncleaved signal-anchor sequence. This is followed by an unconserved, variable length, low complexity region, and then a conserved C-terminal region of about 140 amino acids (see pfam04354) that interacts with the tubulin-like cell division protein FtsZ.
Probab=27.01  E-value=27  Score=32.63  Aligned_cols=26  Identities=31%  Similarity=0.427  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Q 026283          153 FRILILATWVLPIAAPLLIGTVANNF  178 (240)
Q Consensus       153 vn~~l~l~~vlPvaap~li~wWlkRn  178 (240)
                      +|.+||++.++-|+|+++-|||-+|.
T Consensus         2 Lr~iLIIvGaiaI~aLl~hGlwt~Rk   27 (284)
T TIGR02205         2 LRIILIIVGILAIAALLFHGLWTSRK   27 (284)
T ss_pred             ceehHHHHHHHHHHHHHHcccccccc
Confidence            35677888888888899999998765


No 437
>PF03733 DUF307:  Domain of unknown function (DUF307);  InterPro: IPR005185 This proteins contain a domain which occurs as one or more copies in a small family of putative membrane proteins.
Probab=27.00  E-value=1.9e+02  Score=20.62  Aligned_cols=24  Identities=33%  Similarity=0.672  Sum_probs=16.3

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHHH
Q 026283          134 LGRSFATIFFLWFALSGWLFRILI  157 (240)
Q Consensus       134 lG~wL~tl~~~wll~SGWLvn~~l  157 (240)
                      +|+.+=++++.|.+..+|++-+++
T Consensus         2 l~NilW~i~~G~~lal~~~~~~~~   25 (53)
T PF03733_consen    2 LGNILWFIFFGWWLALIWLLAGIL   25 (53)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHH
Confidence            466666677777777777666654


No 438
>KOG3059 consensus N-acetylglucosaminyltransferase complex, subunit PIG-C/GPI2, required for phosphatidylinositol biosynthesis [Lipid transport and metabolism]
Probab=26.78  E-value=2.6e+02  Score=26.83  Aligned_cols=14  Identities=21%  Similarity=0.598  Sum_probs=11.7

Q ss_pred             hhchhHHHHHHHhh
Q 026283          117 RNWPRYRKQLNDFL  130 (240)
Q Consensus       117 r~wP~yrrql~~F~  130 (240)
                      --||.|++.+.++.
T Consensus       209 al~p~~~~~i~~~~  222 (292)
T KOG3059|consen  209 ALLPNFRKRIKKVI  222 (292)
T ss_pred             HHHHHHHHHhhccc
Confidence            45899999998776


No 439
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=26.64  E-value=26  Score=29.58  Aligned_cols=27  Identities=26%  Similarity=0.572  Sum_probs=17.5

Q ss_pred             CCCCCCCcccccccc--------ceeecCCCCcee
Q 026283          182 GACPACKREFIGSKS--------QIIRCAGCGNIV  208 (240)
Q Consensus       182 g~CPvC~~eFtG~nn--------t~~~CpnCGe~l  208 (240)
                      -.||-||..-|-.-+        ..-+|-.|.|+.
T Consensus       106 ~~cp~c~s~~t~~~s~fg~t~cka~~~c~~c~epf  140 (146)
T TIGR02159       106 VQCPRCGSADTTITSIFGPTACKALYRCRACKEPF  140 (146)
T ss_pred             CcCCCCCCCCcEeecCCCChhhHHHhhhhhhCCcH
Confidence            578888877665433        234678887764


No 440
>KOG3012 consensus Uncharacterized conserved protein [Function unknown]
Probab=26.59  E-value=2.1e+02  Score=26.95  Aligned_cols=35  Identities=29%  Similarity=0.401  Sum_probs=21.1

Q ss_pred             hHHHHHHHhhCCCCchHHHHHHHHHHHHH--HH-HHHHH
Q 026283          121 RYRKQLNDFLNTPLGRSFATIFFLWFALS--GW-LFRIL  156 (240)
Q Consensus       121 ~yrrql~~F~~T~lG~wL~tl~~~wll~S--GW-Lvn~~  156 (240)
                      .||||. +=..-.=-+.+..|..+|+..|  || ++.++
T Consensus        68 ~YrKQT-KnQwARDDPaFlVl~s~~l~vssi~~a~~~~l  105 (259)
T KOG3012|consen   68 HYRKQT-KNQWARDDPAFLVLLSLLLVVSSIGWAYVLDL  105 (259)
T ss_pred             hhhhhh-hhhhhccCchHHHHHHHHHHHHHHHHHHHhcc
Confidence            588887 2233333345667777777777  88 55443


No 441
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed
Probab=26.53  E-value=1e+02  Score=29.39  Aligned_cols=21  Identities=5%  Similarity=-0.183  Sum_probs=14.4

Q ss_pred             HHHhhhhhcCCCCCCCccccc
Q 026283          173 TVANNFVIKGACPACKREFIG  193 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG  193 (240)
                      +|+=..++..+--|+..-+..
T Consensus       232 ~~~l~eiv~Ani~VA~~vL~p  252 (357)
T PRK12652        232 PYLLWEIVKANVAIAYVILHP  252 (357)
T ss_pred             HHHHHHHHHHHHHHHHHHcCC
Confidence            555666777777777776664


No 442
>PLN00050 expansin A; Provisional
Probab=26.45  E-value=37  Score=31.26  Aligned_cols=10  Identities=20%  Similarity=0.551  Sum_probs=7.6

Q ss_pred             CCCeeeeecc
Q 026283          229 DDDIIDVDFE  238 (240)
Q Consensus       229 ~pgtIDVe~e  238 (240)
                      ..|+|||++.
T Consensus       137 ~aGii~V~yR  146 (247)
T PLN00050        137 KAGIVPVQYR  146 (247)
T ss_pred             cCCeeeeEEE
Confidence            3499999874


No 443
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=26.16  E-value=28  Score=37.96  Aligned_cols=23  Identities=26%  Similarity=0.751  Sum_probs=18.4

Q ss_pred             CCCCCCCccccccccceeecCCCCce
Q 026283          182 GACPACKREFIGSKSQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~nnt~~~CpnCGe~  207 (240)
                      -.|+.|+++|+.-.   -.||.||..
T Consensus       679 k~~~~~~~~f~~~~---~~~p~~~~~  701 (1171)
T TIGR01054       679 KRCRDCGYQFTEDR---ESCPKCGSE  701 (1171)
T ss_pred             ccCCchhhhccccc---ccccccccc
Confidence            46999999999843   489999843


No 444
>TIGR02230 ATPase_gene1 F0F1-ATPase subunit, putative. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophic stretches and is presumed to be a subunit of the enzyme.
Probab=26.01  E-value=98  Score=25.06  Aligned_cols=23  Identities=35%  Similarity=0.371  Sum_probs=11.9

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHH
Q 026283          134 LGRSFATIFFLWFALSGWLFRIL  156 (240)
Q Consensus       134 lG~wL~tl~~~wll~SGWLvn~~  156 (240)
                      +|-.+++-.++.+.+=-||=+-+
T Consensus        48 IG~~~v~pil~G~~lG~WLD~~~   70 (100)
T TIGR02230        48 IGWSVAIPTLLGVAVGIWLDRHY   70 (100)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhc
Confidence            44444444444444445665555


No 445
>PF07666 MpPF26:  M penetrans paralogue family 26;  InterPro: IPR011655 These proteins include those ascribed to M penetrans paralogue family 26 in [].
Probab=25.97  E-value=1.5e+02  Score=24.99  Aligned_cols=54  Identities=11%  Similarity=0.207  Sum_probs=28.9

Q ss_pred             HHHHHhhCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcCCCCCCCc
Q 026283          124 KQLNDFLNTPLGRSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVANNFVIKGACPACKR  189 (240)
Q Consensus       124 rql~~F~~T~lG~wL~tl~~~wll~SGWLvn~~l~l~~vlPvaap~li~wWlkRnLIeg~CPvC~~  189 (240)
                      .+.++++.-..|.|+.+++.+++.+.-++++.++.+++.            .|=...++.||.++.
T Consensus        45 ~~~~~~~~~~~~~l~igil~i~~~~i~~i~~~Il~Ivl~------------iKis~~k~~~~~~~k   98 (130)
T PF07666_consen   45 NNYEEESSMSIGNLVIGILLIIFSGIFYIVNFILGIVLI------------IKISSLKNKHPEFKK   98 (130)
T ss_pred             cccccccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHhccCccccc
Confidence            344556666667766666655555554555554433322            233345666776654


No 446
>PF11172 DUF2959:  Protein of unknown function (DUF2959);  InterPro: IPR021342  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=25.89  E-value=5.1e+02  Score=23.63  Aligned_cols=25  Identities=12%  Similarity=0.238  Sum_probs=19.2

Q ss_pred             HHHHHHHhhhhhhhhhHhHHHHHHH
Q 026283           66 DAKKTAERIDRQYSVSRRLNSAART   90 (240)
Q Consensus        66 ear~~a~r~D~~Y~vs~r~a~aa~~   90 (240)
                      +-.+.+++++.+|+-|++.|+.++.
T Consensus        61 dLe~~Y~~ln~~ye~s~~~A~~V~~   85 (201)
T PF11172_consen   61 DLEDKYNALNDEYESSEDAAEEVSD   85 (201)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4567889999999988877666543


No 447
>PRK05580 primosome assembly protein PriA; Validated
Probab=25.82  E-value=39  Score=34.42  Aligned_cols=29  Identities=28%  Similarity=0.611  Sum_probs=16.0

Q ss_pred             CCCCCCccccc-cccceeecCCCCceeeee
Q 026283          183 ACPACKREFIG-SKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       183 ~CPvC~~eFtG-~nnt~~~CpnCGe~l~v~  211 (240)
                      .||.|+-.++= .+.....|..||-.-..+
T Consensus       392 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~  421 (679)
T PRK05580        392 ECPHCDASLTLHRFQRRLRCHHCGYQEPIP  421 (679)
T ss_pred             CCCCCCCceeEECCCCeEECCCCcCCCCCC
Confidence            45566554442 134456777777665544


No 448
>PRK12651 putative monovalent cation/H+ antiporter subunit E; Reviewed
Probab=25.64  E-value=1.4e+02  Score=24.91  Aligned_cols=12  Identities=33%  Similarity=0.811  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHH
Q 026283          139 ATIFFLWFALSG  150 (240)
Q Consensus       139 ~tl~~~wll~SG  150 (240)
                      ..++++|++++|
T Consensus         9 l~L~~~W~lL~g   20 (158)
T PRK12651          9 IILAVLWLFLTG   20 (158)
T ss_pred             HHHHHHHHHHhC
Confidence            567889999884


No 449
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type. This model describes a glycyl-tRNA synthetase distinct from the two alpha and two beta chains of the tetrameric E. coli glycyl-tRNA synthetase. This enzyme is a homodimeric class II tRNA synthetase and is recognized by pfam model tRNA-synt_2b, which recognizes His, Ser, Pro, and this set of glycyl-tRNA synthetases.
Probab=25.63  E-value=27  Score=35.40  Aligned_cols=48  Identities=27%  Similarity=0.422  Sum_probs=30.6

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhcCCCCCCCcccc--------------ccccc---------eeecCCCCce
Q 026283          160 TWVLPIAAPLLIGTVANNFVIKGACPACKREFI--------------GSKSQ---------IIRCAGCGNI  207 (240)
Q Consensus       160 ~~vlPvaap~li~wWlkRnLIeg~CPvC~~eFt--------------G~nnt---------~~~CpnCGe~  207 (240)
                      ..++|-.++-.-|+|-+=+=.--.|+.|+..|-              |++..         .+.||+||+.
T Consensus        63 ~~i~~~~v~~aSGh~~~F~D~mv~~~~~~~~~RaD~l~e~~~~~~~~~~~~~~~~~~i~~~~i~~p~~g~~  133 (551)
T TIGR00389        63 PIITPEEVLKASGHVDNFTDWMVDCKSCKERFRADHLIEEKLGKRLWGFSGPELNEVMEKYDINCPNCGGE  133 (551)
T ss_pred             cccCCHHHHHhcCCccccCCceeecCCCCCEecchHHHHHHhhhhcccCCHHHHHHHHHHcCCCCCCCCCC
Confidence            344555555556677666655667889986542              33333         3789999986


No 450
>PF14017 DUF4233:  Protein of unknown function (DUF4233)
Probab=25.62  E-value=2.1e+02  Score=23.13  Aligned_cols=43  Identities=16%  Similarity=0.338  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHH-----------HHHHHHHH-HHHHHHHHHHHHH--------HHHHHhhhhhc
Q 026283          139 ATIFFLWFALS-----------GWLFRILI-LATWVLPIAAPLL--------IGTVANNFVIK  181 (240)
Q Consensus       139 ~tl~~~wll~S-----------GWLvn~~l-~l~~vlPvaap~l--------i~wWlkRnLIe  181 (240)
                      ..+++++++++           ||++..++ ...++.|..+.++        ...++++++.+
T Consensus        40 ~~lav~~i~~~gl~~rpwa~~~g~~lQv~~i~~g~v~p~m~vvG~iF~~~W~~~l~lg~~i~~  102 (107)
T PF14017_consen   40 GVLAVLCILLAGLQRRPWAYWLGWVLQVLLIAGGFVHPAMFVVGVIFAAVWWYALYLGRRIDR  102 (107)
T ss_pred             HHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45555666655           78777774 3444455544433        23556666554


No 451
>KOG1792 consensus Reticulon [Intracellular trafficking, secretion, and vesicular transport]
Probab=25.53  E-value=1.6e+02  Score=26.90  Aligned_cols=41  Identities=15%  Similarity=0.222  Sum_probs=31.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 026283          136 RSFATIFFLWFALSGWLFRILILATWVLPIAAPLLIGTVAN  176 (240)
Q Consensus       136 ~wL~tl~~~wll~SGWLvn~~l~l~~vlPvaap~li~wWlk  176 (240)
                      -.|+...++|++...-=++++.+...++++++.++|+|--.
T Consensus        57 ~vl~~~~~~w~lf~~~~~~~vt~~~~i~ll~~~i~F~w~~~   97 (230)
T KOG1792|consen   57 TVLGVATALWLLFEFFSYNSVTLLCHILLLALAILFLWSKA   97 (230)
T ss_pred             eehHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            34566677888888777888888888888888888887643


No 452
>PF10864 DUF2663:  Protein of unknown function (DUF2663);  InterPro: IPR020210 This entry represents a group of uncharacterised transmembrane proteins.
Probab=25.47  E-value=1.7e+02  Score=24.83  Aligned_cols=63  Identities=16%  Similarity=0.280  Sum_probs=33.8

Q ss_pred             hhhchhHHHHHHHhhCCCCchHHHHHHHHHHHHHH--H--HHHHH----HHHHHHHHHHHHHHHHHHHhhh
Q 026283          116 SRNWPRYRKQLNDFLNTPLGRSFATIFFLWFALSG--W--LFRIL----ILATWVLPIAAPLLIGTVANNF  178 (240)
Q Consensus       116 ~r~wP~yrrql~~F~~T~lG~wL~tl~~~wll~SG--W--Lvn~~----l~l~~vlPvaap~li~wWlkRn  178 (240)
                      -++|-+|.+|..-.+...+.+..+.+..+-..+.+  |  ++..|    +.++|++-+++.+..-.+++..
T Consensus        10 K~K~e~l~k~~~~~~~~~l~~~~~~~~y~~~~~~~~s~~~~~s~~~~~~~~l~~ll~~~~~~~~~~~~~kK   80 (130)
T PF10864_consen   10 KEKWERLKKQHLFWQWLFLFSLFLFFIYFYIKVIGYSFSSFLSAILGSPVHLFWLLALAFSYWAMYYLKKK   80 (130)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCHHHHHHHHHcChHHHHHHHHHHHHHHHHHHHHhh
Confidence            36888999998777765555544333333333323  3  22223    3555555555455555555543


No 453
>PF04135 Nop10p:  Nucleolar RNA-binding protein, Nop10p family;  InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs. More than 100 mammalian H/ACA RNAs form an equal number of ribonucleoproteins (RNPs) by associating with the same four core proteins: Cbf5, Gar1, Nhp2 and Nop10. The function of these H/ACA RNPs is essential for biogenesis of the ribosome, splicing of precursor mRNAs (pre-mRNAs), maintenance of telomeres and probably for additional cellular processes []. Recent crystal structures of archaeal H/ACA protein complexes show how the same four proteins accommodate >100 distinct but related H/ACA RNAs []. The complex contains a stable core composed of Cbf5 and Nop10, to which Gar1 and Nhp2 subsequently bind, the complex interacts with snoRNAs []. In eukaryotes Nop10 is a nucleolar protein that is specifically associated with H/ACA snoRNAs. It is essential for normal 18S rRNA production and rRNA pseudouridylation by the ribonucleoprotein particles containing H/ACA snoRNAs (H/ACA snoRNPs). Nop10 is probably necessary for the stability of these RNPs [].; PDB: 2RFK_B 3LWR_B 2HVY_C 3HAX_C 3MQK_B 3LWO_B 3LWV_B 3HAY_C 3HJY_B 2EY4_E ....
Probab=25.39  E-value=56  Score=23.85  Aligned_cols=28  Identities=29%  Similarity=0.783  Sum_probs=18.8

Q ss_pred             CCCCCCccccccccceeecCCCCceeeeeC-CCc
Q 026283          183 ACPACKREFIGSKSQIIRCAGCGNIVWQPE-GDF  215 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~-g~F  215 (240)
                      .|+.|+. +| ++   -.||-||++...+. -.|
T Consensus         7 ~c~~~~~-YT-Lk---~~cp~cG~~T~~ahPaRF   35 (53)
T PF04135_consen    7 KCPGCRV-YT-LK---DKCPPCGGPTESAHPARF   35 (53)
T ss_dssp             ECTTTCE-EE-SS---SBBTTTSSBSEESSSSSS
T ss_pred             cCCCCCc-Ee-CC---CccCCCCCCCcCCcCCCC
Confidence            4777771 11 11   48999999988877 455


No 454
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]
Probab=25.26  E-value=66  Score=25.96  Aligned_cols=23  Identities=22%  Similarity=0.619  Sum_probs=15.6

Q ss_pred             ccccceeecCCCC-ceeeeeCCCc
Q 026283          193 GSKSQIIRCAGCG-NIVWQPEGDF  215 (240)
Q Consensus       193 G~nnt~~~CpnCG-e~l~v~~g~F  215 (240)
                      ++..+...||+|| -.+....|+|
T Consensus        55 ~~~~~~~~Cp~C~~~~~~~k~~~~   78 (140)
T COG0551          55 IAEKTGVKCPKCGKGLLVLKKGRF   78 (140)
T ss_pred             ccccCceeCCCCCCCceEEEeccC
Confidence            3445568999999 4666666654


No 455
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=25.17  E-value=26  Score=29.75  Aligned_cols=25  Identities=28%  Similarity=0.744  Sum_probs=20.3

Q ss_pred             cccccceeecCCCCceeeeeCCCcc
Q 026283          192 IGSKSQIIRCAGCGNIVWQPEGDFF  216 (240)
Q Consensus       192 tG~nnt~~~CpnCGe~l~v~~g~F~  216 (240)
                      .|..-....||-||-||...+|+-|
T Consensus        22 ~GAkML~~hCp~Cg~PLF~KdG~v~   46 (131)
T COG1645          22 QGAKMLAKHCPKCGTPLFRKDGEVF   46 (131)
T ss_pred             hhhHHHHhhCcccCCcceeeCCeEE
Confidence            3555566789999999999999874


No 456
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=25.05  E-value=40  Score=27.03  Aligned_cols=33  Identities=27%  Similarity=0.677  Sum_probs=20.3

Q ss_pred             cCCCCCCCcccccccc-ceeecCCCCceeeeeCCCc
Q 026283          181 KGACPACKREFIGSKS-QIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       181 eg~CPvC~~eFtG~nn-t~~~CpnCGe~l~v~~g~F  215 (240)
                      +-.||.|+..-+-=.. -+-+|..||+.  +..|-+
T Consensus        35 ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~--~AGGAy   68 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRVATGIWKCKKCGKK--FAGGAY   68 (90)
T ss_dssp             -BEESSSSSSEEEEEETTEEEETTTTEE--EE-BSS
T ss_pred             CCcCCCCCCceeEEeeeEEeecCCCCCE--EeCCCc
Confidence            4579999987532222 23689999964  455554


No 457
>COG5345 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.05  E-value=1.2e+02  Score=29.54  Aligned_cols=26  Identities=12%  Similarity=0.020  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 026283          150 GWLFRILILATWVLPIAAPLLIGTVAN  176 (240)
Q Consensus       150 GWLvn~~l~l~~vlPvaap~li~wWlk  176 (240)
                      +||++++++|+.+--.+ .+..+||-+
T Consensus        29 ~Wlvkv~~~L~g~Y~~f-~~~tq~w~n   54 (358)
T COG5345          29 PWLVKVVGGLLGIYLYF-AWQTQWWTN   54 (358)
T ss_pred             ccHHHHHHHHHHHHHHH-HHHHHhhhc
Confidence            89999877766665544 455677754


No 458
>PRK12860 transcriptional activator FlhC; Provisional
Probab=24.85  E-value=67  Score=28.72  Aligned_cols=38  Identities=16%  Similarity=0.340  Sum_probs=27.7

Q ss_pred             HHHHHHHHhhhhhcCCCCCCCccccccccc---eeecCCCC
Q 026283          168 PLLIGTVANNFVIKGACPACKREFIGSKSQ---IIRCAGCG  205 (240)
Q Consensus       168 p~li~wWlkRnLIeg~CPvC~~eFtG~nnt---~~~CpnCG  205 (240)
                      +-|.+..-...|---.|.-|+-+|+.-++.   ...||-|.
T Consensus       121 w~LvRf~~s~~L~l~~C~~Cgg~fv~~~~e~~~~f~CplC~  161 (189)
T PRK12860        121 WTLVRFFDAGMLQLARCCRCGGKFVTHAHDLRHNFVCGLCQ  161 (189)
T ss_pred             HHHHHHhcCCCeeeccCCCCCCCeeccccccCCCCcCCCCC
Confidence            334444444456666899999999988775   47899998


No 459
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=24.79  E-value=57  Score=26.95  Aligned_cols=26  Identities=23%  Similarity=0.568  Sum_probs=20.4

Q ss_pred             CCCCCCCccccccc----cceeecCCCCce
Q 026283          182 GACPACKREFIGSK----SQIIRCAGCGNI  207 (240)
Q Consensus       182 g~CPvC~~eFtG~n----nt~~~CpnCGe~  207 (240)
                      -.||.|+.+=|-+.    --...|-.||..
T Consensus        94 VlC~~C~spdT~l~k~~r~~~l~C~aCGa~  123 (125)
T PF01873_consen   94 VLCPECGSPDTELIKEGRLIFLKCKACGAS  123 (125)
T ss_dssp             SSCTSTSSSSEEEEEETTCCEEEETTTSCE
T ss_pred             EEcCCCCCCccEEEEcCCEEEEEecccCCc
Confidence            47999999988773    356789999964


No 460
>PRK14288 chaperone protein DnaJ; Provisional
Probab=24.71  E-value=36  Score=32.09  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=5.8

Q ss_pred             ccccceeecCCC
Q 026283          193 GSKSQIIRCAGC  204 (240)
Q Consensus       193 G~nnt~~~CpnC  204 (240)
                      |+.+++..||.|
T Consensus       173 g~~~~~~~C~~C  184 (369)
T PRK14288        173 GFMSFAQTCGAC  184 (369)
T ss_pred             ceEEEEEecCCC
Confidence            344444455555


No 461
>PRK14297 chaperone protein DnaJ; Provisional
Probab=24.63  E-value=41  Score=31.75  Aligned_cols=13  Identities=38%  Similarity=0.807  Sum_probs=9.0

Q ss_pred             ccccceeecCCCC
Q 026283          193 GSKSQIIRCAGCG  205 (240)
Q Consensus       193 G~nnt~~~CpnCG  205 (240)
                      |+-+++..|+.|+
T Consensus       186 G~~~~~~~C~~C~  198 (380)
T PRK14297        186 GSFVSTTTCDKCG  198 (380)
T ss_pred             ceeEEEEeCCCCC
Confidence            5556677787774


No 462
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=24.60  E-value=1.5e+02  Score=21.39  Aligned_cols=32  Identities=22%  Similarity=0.194  Sum_probs=21.3

Q ss_pred             hhHHHHHHHhhCCCCchHHHHHHHHHHHHH-HH
Q 026283          120 PRYRKQLNDFLNTPLGRSFATIFFLWFALS-GW  151 (240)
Q Consensus       120 P~yrrql~~F~~T~lG~wL~tl~~~wll~S-GW  151 (240)
                      +.-+--+...+.+|.|+|+..+.-+-+++. .|
T Consensus        31 ~~~~~~~~~l~~~p~G~~ll~~vg~gli~~gi~   63 (73)
T PF06724_consen   31 QGSQGALAWLLEQPFGRWLLGAVGLGLIGYGIW   63 (73)
T ss_pred             CCHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHH
Confidence            334455677889999998866665555554 44


No 463
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=24.59  E-value=34  Score=30.20  Aligned_cols=36  Identities=25%  Similarity=0.599  Sum_probs=24.1

Q ss_pred             hhhcCCCCCCCcccccccc-----ceeecCCCCceeeeeCCCc
Q 026283          178 FVIKGACPACKREFIGSKS-----QIIRCAGCGNIVWQPEGDF  215 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nn-----t~~~CpnCGe~l~v~~g~F  215 (240)
                      .++++-||.|=.+=.++-.     +..+||.||-...-  |+.
T Consensus        10 ~~~~~lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~~~~~--~~W   50 (236)
T PF04981_consen   10 PLIDGLCPDCYLKRFDIIEIPDRIEVTICPKCGRYRIG--GRW   50 (236)
T ss_pred             CcccccChHHhcccCCeeecCCccCceECCCCCCEECC--CEe
Confidence            3566788888665555522     67899999986543  444


No 464
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=24.45  E-value=63  Score=21.65  Aligned_cols=18  Identities=17%  Similarity=0.446  Sum_probs=13.6

Q ss_pred             ceeecCCCCcee-eeeCCC
Q 026283          197 QIIRCAGCGNIV-WQPEGD  214 (240)
Q Consensus       197 t~~~CpnCGe~l-~v~~g~  214 (240)
                      -.+.||.|+..- .+.+|+
T Consensus         4 i~v~CP~C~s~~~v~k~G~   22 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGK   22 (36)
T ss_pred             EeeeCCCCCCCCcceeCCC
Confidence            456799998887 667775


No 465
>PRK11595 DNA utilization protein GntX; Provisional
Probab=24.43  E-value=25  Score=30.59  Aligned_cols=9  Identities=33%  Similarity=0.785  Sum_probs=5.0

Q ss_pred             ecCCCCcee
Q 026283          200 RCAGCGNIV  208 (240)
Q Consensus       200 ~CpnCGe~l  208 (240)
                      .|+.||.++
T Consensus        36 ~C~~Cg~~~   44 (227)
T PRK11595         36 CCPQCGLPA   44 (227)
T ss_pred             cCccCCCcC
Confidence            466666543


No 466
>PF11587 Prion_bPrPp:  Major prion protein bPrPp - N terminal; PDB: 1SKH_A.
Probab=24.42  E-value=61  Score=21.44  Aligned_cols=13  Identities=23%  Similarity=0.360  Sum_probs=10.0

Q ss_pred             CCCchHHHHHHHH
Q 026283          132 TPLGRSFATIFFL  144 (240)
Q Consensus       132 T~lG~wL~tl~~~  144 (240)
                      +.+|||+..||++
T Consensus         4 ~~lgcWilvLfva   16 (29)
T PF11587_consen    4 SHLGCWILVLFVA   16 (29)
T ss_dssp             TTTTTHHHHHHHH
T ss_pred             ccccHHHHHHHHH
Confidence            4689999877763


No 467
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional
Probab=24.42  E-value=4.3e+02  Score=23.69  Aligned_cols=73  Identities=18%  Similarity=0.234  Sum_probs=42.0

Q ss_pred             HHhhHHHHHhHHHHHHHHHhhh-----------hhhhhhHhHHHHHHHHHHHHHHhhhhhh----hhHhHHhhhhhhhhh
Q 026283           54 RTANNGFEQLVFDAKKTAERID-----------RQYSVSRRLNSAARTAAVRARELDREFA----ISVRWRSFRMDFSRN  118 (240)
Q Consensus        54 r~an~~~e~~~fear~~a~r~D-----------~~Y~vs~r~a~aa~~a~e~A~eiD~~fg----i~rR~R~f~~D~~r~  118 (240)
                      +++|.++|...--|...+..++           ++|+-.||  ..++.....++.+.+.|.    ..+..|.+......+
T Consensus       298 qG~n~ai~Da~~La~~L~~~~~~~~~~~~~~~L~~Ye~~R~--~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~  375 (403)
T PRK07333        298 QGLNLGLKDVAALAEVVVEAARLGLDIGSLDVLERYQRWRR--FDTVRMGVTTDVLNRLFSNDSTLLRSVRDIGLGLVDR  375 (403)
T ss_pred             cchhhhHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHh--HHHHHHHHHHHHHHHHHcCCchHHHHHHHHHHHHHhc
Confidence            4566677766665555544331           45664333  223333344444554443    556778888888888


Q ss_pred             chhHHHHHHH
Q 026283          119 WPRYRKQLND  128 (240)
Q Consensus       119 wP~yrrql~~  128 (240)
                      .|..++.+.+
T Consensus       376 ~~~~~~~~~~  385 (403)
T PRK07333        376 LPKLKSFFIR  385 (403)
T ss_pred             CHHHHHHHHH
Confidence            8887776643


No 468
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=24.40  E-value=37  Score=25.14  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=8.6

Q ss_pred             eeecCCCCcee
Q 026283          198 IIRCAGCGNIV  208 (240)
Q Consensus       198 ~~~CpnCGe~l  208 (240)
                      ...||||||..
T Consensus        27 ~~~c~~cG~~~   37 (57)
T COG0333          27 LSVCPNCGEYK   37 (57)
T ss_pred             ceeccCCCCcc
Confidence            56799999864


No 469
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=24.37  E-value=30  Score=25.92  Aligned_cols=14  Identities=29%  Similarity=0.821  Sum_probs=9.9

Q ss_pred             eeecCCCCceeeee
Q 026283          198 IIRCAGCGNIVWQP  211 (240)
Q Consensus       198 ~~~CpnCGe~l~v~  211 (240)
                      .++|..||.++.-.
T Consensus         4 PVRCFTCGkvi~~~   17 (60)
T PF01194_consen    4 PVRCFTCGKVIGNK   17 (60)
T ss_dssp             SSS-STTTSBTCGH
T ss_pred             ceecCCCCCChhHh
Confidence            36899999998543


No 470
>PRK10633 hypothetical protein; Provisional
Probab=24.33  E-value=2.9e+02  Score=21.69  Aligned_cols=28  Identities=11%  Similarity=0.241  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 026283          150 GWLFRILILATWVLPIAAPLLIGTVANN  177 (240)
Q Consensus       150 GWLvn~~l~l~~vlPvaap~li~wWlkR  177 (240)
                      -|.+-|-|++.++.-++..+.++...|.
T Consensus        44 ~WF~~sCi~~p~lfi~l~~~~Vk~vFkD   71 (80)
T PRK10633         44 HWFEMACLLLPLLFILLCWLMVKFIFRD   71 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            4655555554444444444445554443


No 471
>PF09527 ATPase_gene1:  Putative F0F1-ATPase subunit (ATPase_gene1)
Probab=24.27  E-value=1.2e+02  Score=20.95  Aligned_cols=23  Identities=17%  Similarity=0.288  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhh
Q 026283          157 ILATWVLPIAAPLLIGTVANNFV  179 (240)
Q Consensus       157 l~l~~vlPvaap~li~wWlkRnL  179 (240)
                      +++.++.|+++...++||+-+.+
T Consensus         6 lg~~~~~~i~~g~~~G~~lD~~~   28 (55)
T PF09527_consen    6 LGFTMAAPILVGFFLGYWLDKWF   28 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHc
Confidence            46677778887888888887765


No 472
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=24.13  E-value=47  Score=32.90  Aligned_cols=36  Identities=22%  Similarity=0.328  Sum_probs=26.3

Q ss_pred             hhcCCCCCCCccccccc----cce-----eecCCCCceeeeeCCC
Q 026283          179 VIKGACPACKREFIGSK----SQI-----IRCAGCGNIVWQPEGD  214 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~n----nt~-----~~CpnCGe~l~v~~g~  214 (240)
                      ++.--||.|-.++..-+    +..     .+||.|+.+|.+..-+
T Consensus        24 i~~~yCp~CL~~~p~~e~~~~~nrC~r~Cf~CP~C~~~L~~~~~~   68 (483)
T PF05502_consen   24 IDSYYCPNCLFEVPSSEARSEKNRCSRNCFDCPICFSPLSVRASD   68 (483)
T ss_pred             cceeECccccccCChhhheeccceeccccccCCCCCCcceeEecc
Confidence            44456999988887643    222     4699999999998655


No 473
>TIGR02896 spore_III_AF stage III sporulation protein AF. This family represents the stage III sporulation protein AF of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of this protein is poorly conserved, so only the N-terminal region, which includes two predicted transmembrane domains, is included in the seed alignment.
Probab=24.10  E-value=1.9e+02  Score=23.36  Aligned_cols=37  Identities=19%  Similarity=0.145  Sum_probs=19.4

Q ss_pred             CchHHHHHHHHHHHHH--------------HHHHHHH-HHHHHHHHHHHHHH
Q 026283          134 LGRSFATIFFLWFALS--------------GWLFRIL-ILATWVLPIAAPLL  170 (240)
Q Consensus       134 lG~wL~tl~~~wll~S--------------GWLvn~~-l~l~~vlPvaap~l  170 (240)
                      +..|+..|.++-++.+              .=+|-|+ ++++++.|++.++.
T Consensus         3 l~~Wv~~i~~~~il~t~~~~llP~~~~kkYvr~v~Gl~Li~~il~Pi~~l~~   54 (106)
T TIGR02896         3 LKEWVTNIIVLILLATILEMLLPNSSLKKYVKFVVGLILMVVILNPIIKLLT   54 (106)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCccHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            3457766666555554              1122222 45666677775554


No 474
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional
Probab=23.85  E-value=59  Score=30.36  Aligned_cols=34  Identities=29%  Similarity=0.445  Sum_probs=18.5

Q ss_pred             cCCCCCCCcc----ccccccceeecCCCC-ceeeeeCCC
Q 026283          181 KGACPACKRE----FIGSKSQIIRCAGCG-NIVWQPEGD  214 (240)
Q Consensus       181 eg~CPvC~~e----FtG~nnt~~~CpnCG-e~l~v~~g~  214 (240)
                      ..+||+|+..    +....++...-.-|| +.+++..+.
T Consensus       237 ~p~Cp~Cg~~~~~~~l~~~~~~~~~~LCgr~~vq~~~~~  275 (338)
T PRK12475        237 KDTCPSCGLTRTYPSLTFENQTKTEVLCGRNTVQIRPGV  275 (338)
T ss_pred             CCCCCcCCCCCcccccccccCCCeeeccCCceeeeecCc
Confidence            4668888742    223344444456677 455555553


No 475
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family. Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase. Some species with this reductase lack NapC but accomplish electron transfer to NapAB in some other manner, likely to involve NapH, NapG, and/or some other protein. A few members of this protein are designated MauN and are found in methylamine utilization operons in species that appear to lack a periplasmic nitrate reductase.
Probab=23.82  E-value=5.3e+02  Score=23.04  Aligned_cols=13  Identities=15%  Similarity=0.197  Sum_probs=7.4

Q ss_pred             HHHhhhhhcCCCC
Q 026283          173 TVANNFVIKGACP  185 (240)
Q Consensus       173 wWlkRnLIeg~CP  185 (240)
                      .+.+|..=.--||
T Consensus       167 ~~~~r~~C~~~CP  179 (255)
T TIGR02163       167 LFSERGWCGHLCP  179 (255)
T ss_pred             HhcCCchhhCcCC
Confidence            4455555555666


No 476
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=23.71  E-value=35  Score=36.22  Aligned_cols=30  Identities=30%  Similarity=0.759  Sum_probs=24.5

Q ss_pred             CCCCCCcccccccc-----ceeecCCCCceeeeeC
Q 026283          183 ACPACKREFIGSKS-----QIIRCAGCGNIVWQPE  212 (240)
Q Consensus       183 ~CPvC~~eFtG~nn-----t~~~CpnCGe~l~v~~  212 (240)
                      -||.|..|+.--.|     |.+-||.||=.++..+
T Consensus       153 lC~~C~~EY~dP~nRRfHAQp~aCp~CGP~~~l~~  187 (750)
T COG0068         153 LCPFCDKEYKDPLNRRFHAQPIACPKCGPHLFLVN  187 (750)
T ss_pred             CCHHHHHHhcCccccccccccccCcccCCCeEEEc
Confidence            48999998877655     6678999999888874


No 477
>PF13829 DUF4191:  Domain of unknown function (DUF4191)
Probab=23.71  E-value=3.1e+02  Score=25.25  Aligned_cols=22  Identities=23%  Similarity=0.211  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHhhhh---hcCCC
Q 026283          163 LPIAAPLLIGTVANNFV---IKGAC  184 (240)
Q Consensus       163 lPvaap~li~wWlkRnL---Ieg~C  184 (240)
                      .-+++.++|+.-+++..   +||+=
T Consensus        63 g~l~am~vl~rra~ra~Y~qieGqp   87 (224)
T PF13829_consen   63 GLLAAMIVLSRRAQRAAYAQIEGQP   87 (224)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            33444555666666543   45543


No 478
>COG5005 Mu-like prophage protein gpG [General function prediction only]
Probab=23.69  E-value=1.2e+02  Score=26.27  Aligned_cols=36  Identities=19%  Similarity=0.245  Sum_probs=30.1

Q ss_pred             HHHHHHHhhhhhhhhhHhHHHHHHHHHHHHHHhhhh
Q 026283           66 DAKKTAERIDRQYSVSRRLNSAARTAAVRARELDRE  101 (240)
Q Consensus        66 ear~~a~r~D~~Y~vs~r~a~aa~~a~e~A~eiD~~  101 (240)
                      ...+.|+-.|.+|.+.|++|+.-++|.+++=|+..+
T Consensus        15 ~~~~laq~~~~rk~Lmr~vA~~m~sav~~nF~~~gr   50 (140)
T COG5005          15 KLEALAQVTDGRKDLMRSVAGTMRSAVEKNFELEGR   50 (140)
T ss_pred             HHHHHHHhhccccHHHHHHHHHHHHHHHHHHHhcCC
Confidence            445678889999999999999999999988776543


No 479
>cd03509 DesA_FADS-like Fatty acid desaturase protein family subgroup, a delta-12 acyl-lipid desaturase-like, DesA-like, yet uncharacterized subgroup of membrane fatty acid desaturase proteins found in alpha-, beta-, and gamma-proteobacteria. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of these sequences also reveals three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.
Probab=23.64  E-value=3.9e+02  Score=24.53  Aligned_cols=14  Identities=36%  Similarity=0.432  Sum_probs=5.7

Q ss_pred             HHHHHHHhhCCCCc
Q 026283          122 YRKQLNDFLNTPLG  135 (240)
Q Consensus       122 yrrql~~F~~T~lG  135 (240)
                      ++|.++..+.+++|
T Consensus       113 ~~r~~~~~~~~~~~  126 (288)
T cd03509         113 WQRALLRANNTLLG  126 (288)
T ss_pred             HHHHHHHHhhcchh
Confidence            34444444444333


No 480
>PF01214 CK_II_beta:  Casein kinase II regulatory subunit;  InterPro: IPR000704 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Casein kinase, a ubiquitous, well-conserved protein kinase involved in cell metabolism and differentiation, is characterised by its preference for Ser or Thr in acidic stretches of amino acids. The enzyme is a tetramer of 2 alpha- and 2 beta-subunits [, ]. However, some species (e.g., mammals) possess 2 related forms of the alpha-subunit (alpha and alpha'), while others (e.g., fungi) possess 2 related beta-subunits (beta and beta') []. The alpha-subunit is the catalytic unit and contains regions characteristic of serine/threonine protein kinases. The beta-subunit is believed to be regulatory, possessing an N-terminal auto-phosphorylation site, an internal acidic domain, and a potential metal-binding motif []. The beta subunit is a highly conserved protein of about 25kDa that contains, in its central section, a cysteine-rich motif, CX(n)C, that could be involved in binding a metal such as zinc []. The mammalian beta-subunit gene promoter shares common features with those of other mammalian protein kinases and is closely related to the promoter of the regulatory subunit of cAMP-dependent protein kinase [].; GO: 0019887 protein kinase regulator activity, 0005956 protein kinase CK2 complex; PDB: 2R6M_B 1RQF_K 1DS5_G 1QF8_B 3EED_A 4DGL_A 1JWH_D.
Probab=23.60  E-value=50  Score=28.89  Aligned_cols=34  Identities=24%  Similarity=0.612  Sum_probs=20.6

Q ss_pred             hcCCCC--CCCcc---------ccccccceeecCCCCceeeeeCC
Q 026283          180 IKGACP--ACKRE---------FIGSKSQIIRCAGCGNIVWQPEG  213 (240)
Q Consensus       180 Ieg~CP--vC~~e---------FtG~nnt~~~CpnCGe~l~v~~g  213 (240)
                      +-|.||  -|+.+         =.|-......||+|.++-..++.
T Consensus        98 ~FG~CPRv~C~~~~lLPiGlsd~~g~~~vKlyCP~C~dvY~p~~~  142 (184)
T PF01214_consen   98 DFGRCPRVYCNGQPLLPIGLSDTPGESTVKLYCPRCKDVYHPPSS  142 (184)
T ss_dssp             TT-B-SBGGGTT-B-EEEBS-SSTTS-BBEEEETTTTEEE--SSG
T ss_pred             cCCcCCcccCCCCceeCccCCCCCCccceeEECCCCccccCCCCc
Confidence            458999  67754         23666778999999998776443


No 481
>PRK14291 chaperone protein DnaJ; Provisional
Probab=23.50  E-value=38  Score=32.02  Aligned_cols=13  Identities=31%  Similarity=0.598  Sum_probs=7.1

Q ss_pred             ccccceeecCCCC
Q 026283          193 GSKSQIIRCAGCG  205 (240)
Q Consensus       193 G~nnt~~~CpnCG  205 (240)
                      |+-+++..|+.|+
T Consensus       190 g~~~~~~~C~~C~  202 (382)
T PRK14291        190 GFFRISQTCPTCG  202 (382)
T ss_pred             ceEEEEecCCCCC
Confidence            4444555666663


No 482
>PF04956 TrbC:  TrbC/VIRB2 family;  InterPro: IPR007039 Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure[]. This family also contains several VirB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species [].
Probab=23.45  E-value=1.2e+02  Score=22.59  Aligned_cols=46  Identities=22%  Similarity=0.524  Sum_probs=30.9

Q ss_pred             hhchhHHHHHHHhhCCCCchHHHHHHHHHHHHH--------HHHHHHHHHHHHH
Q 026283          117 RNWPRYRKQLNDFLNTPLGRSFATIFFLWFALS--------GWLFRILILATWV  162 (240)
Q Consensus       117 r~wP~yrrql~~F~~T~lG~wL~tl~~~wll~S--------GWLvn~~l~l~~v  162 (240)
                      -+|=..=..+.++...|+|..+.++.+++....        +|+++.++++.++
T Consensus        36 ~~~~~~l~~i~~~l~gp~~~~i~~i~ii~~g~~~~~g~~~~~~~~~~v~G~~iv   89 (99)
T PF04956_consen   36 DPWTSFLCKIIDWLTGPIGKAIAIIAIIVAGIMMMFGRQSWRWFIGVVIGIIIV   89 (99)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCcCHHHHHHHHHHHHHH
Confidence            344455566777888889999988887766555        6677766644433


No 483
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=23.39  E-value=38  Score=28.38  Aligned_cols=12  Identities=33%  Similarity=0.935  Sum_probs=9.0

Q ss_pred             CCCCCCCccccc
Q 026283          182 GACPACKREFIG  193 (240)
Q Consensus       182 g~CPvC~~eFtG  193 (240)
                      -.||.||.+|-+
T Consensus        50 t~CP~Cg~~~e~   61 (115)
T COG1885          50 TSCPKCGEPFES   61 (115)
T ss_pred             ccCCCCCCccce
Confidence            468888888754


No 484
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=23.38  E-value=36  Score=25.28  Aligned_cols=26  Identities=31%  Similarity=0.615  Sum_probs=18.8

Q ss_pred             cCCCCCCCccccccccceeecCCCCcee
Q 026283          181 KGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       181 eg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      --.|.-||..  .|+-|.-+|.+||-+-
T Consensus        15 H~~CrRCG~~--syH~qK~~CasCGyp~   40 (55)
T PF01907_consen   15 HTLCRRCGRR--SYHIQKKTCASCGYPA   40 (55)
T ss_dssp             EEE-TTTSSE--EEETTTTEETTTBTTT
T ss_pred             EeeecccCCe--eeecCCCcccccCCCc
Confidence            3458888875  5788888899998653


No 485
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specifici
Probab=23.33  E-value=84  Score=24.17  Aligned_cols=29  Identities=17%  Similarity=0.233  Sum_probs=18.8

Q ss_pred             CCCCCcccccccccee----ecCCCCceeeeeCCC
Q 026283          184 CPACKREFIGSKSQII----RCAGCGNIVWQPEGD  214 (240)
Q Consensus       184 CPvC~~eFtG~nnt~~----~CpnCGe~l~v~~g~  214 (240)
                      ||+|++..  +.+...    -+-+.|++|-+++.+
T Consensus         1 c~~~~~~~--~~~~~~~v~~ii~~~~~vLL~kr~~   33 (130)
T cd04511           1 CPDCGYIH--YQNPKIIVGCVPEWEGKVLLCRRAI   33 (130)
T ss_pred             CCCCcccc--CCCCcEEEEEEEecCCEEEEEEecC
Confidence            99999844  344422    235668888887643


No 486
>PRK14278 chaperone protein DnaJ; Provisional
Probab=23.29  E-value=42  Score=31.76  Aligned_cols=14  Identities=21%  Similarity=0.539  Sum_probs=8.1

Q ss_pred             cccccceeecCCCC
Q 026283          192 IGSKSQIIRCAGCG  205 (240)
Q Consensus       192 tG~nnt~~~CpnCG  205 (240)
                      .|.-+++..|+.|+
T Consensus       176 ~g~~~~~~~C~~C~  189 (378)
T PRK14278        176 LGQVMTSRPCPTCR  189 (378)
T ss_pred             ceeEEEEEECCCCC
Confidence            35555566677773


No 487
>PRK07220 DNA topoisomerase I; Validated
Probab=23.23  E-value=55  Score=33.92  Aligned_cols=37  Identities=22%  Similarity=0.377  Sum_probs=0.0

Q ss_pred             hhhcCCCCCCCc-cccccccc----eeecCCCCceeeeeCCC
Q 026283          178 FVIKGACPACKR-EFIGSKSQ----IIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       178 nLIeg~CPvC~~-eFtG~nnt----~~~CpnCGe~l~v~~g~  214 (240)
                      ..+...||.|+. .+.-.+..    ...||+|.-.-++....
T Consensus       632 ~~~~~~Cp~Cg~~~~k~~~~g~~~~~~~Cp~C~~~~~~~~~~  673 (740)
T PRK07220        632 IVTDKVCEAHGLNHIRIINGGKRPWDLGCPQCNFIEWQKKQK  673 (740)
T ss_pred             ccCCCCCCCCCCceEEEEecCCccceeeCCCCCCccccCCcc


No 488
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=23.19  E-value=19  Score=36.37  Aligned_cols=37  Identities=22%  Similarity=0.592  Sum_probs=26.3

Q ss_pred             HHHhhhhhcCCCCCCCccccccccceeecCCCCceeeee
Q 026283          173 TVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQP  211 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~  211 (240)
                      -|+...-| --||-|+..| |+.+.+--|-=||-++=-.
T Consensus       173 pW~DDs~V-~~CP~Ca~~F-~l~rRrHHCRLCG~VmC~~  209 (505)
T KOG1842|consen  173 PWLDDSSV-QFCPECANSF-GLTRRRHHCRLCGRVMCRD  209 (505)
T ss_pred             cccCCCcc-cccccccchh-hhHHHhhhhhhcchHHHHH
Confidence            34444333 3599999998 6888888899999876433


No 489
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=23.19  E-value=67  Score=25.73  Aligned_cols=37  Identities=16%  Similarity=0.200  Sum_probs=28.7

Q ss_pred             HHHhhhhhcCCCCCCCccccccccceeecCCCCceeeeeCCC
Q 026283          173 TVANNFVIKGACPACKREFIGSKSQIIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l~v~~g~  214 (240)
                      ..++|..--..||.|+..|-=     ..|++|+.+|....++
T Consensus       117 ~~~~Rl~~R~~~~~~~~~~~~-----~~~~~~~~~l~~r~dd  153 (194)
T cd01428         117 VLIERILGRRICPVSGRVYHL-----GKDDVTGEPLSQRSDD  153 (194)
T ss_pred             HHHHHHHcCCcCCCcCCcCCc-----CCCcccCCccccCCCC
Confidence            556676667889999988765     8999999998865543


No 490
>PHA02446 hypothetical protein
Probab=23.13  E-value=38  Score=29.32  Aligned_cols=15  Identities=27%  Similarity=0.683  Sum_probs=12.8

Q ss_pred             eeecCCCCceeeeeC
Q 026283          198 IIRCAGCGNIVWQPE  212 (240)
Q Consensus       198 ~~~CpnCGe~l~v~~  212 (240)
                      +.+||-||+--||..
T Consensus        62 ~q~cp~cg~dawv~~   76 (166)
T PHA02446         62 QQQCPLCGQDAWVIH   76 (166)
T ss_pred             hhcCCCcccceeEee
Confidence            568999999999865


No 491
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.11  E-value=48  Score=35.54  Aligned_cols=27  Identities=30%  Similarity=0.642  Sum_probs=18.4

Q ss_pred             hhhcCCCCCCC--------ccccccccceeecCCCCc
Q 026283          178 FVIKGACPACK--------REFIGSKSQIIRCAGCGN  206 (240)
Q Consensus       178 nLIeg~CPvC~--------~eFtG~nnt~~~CpnCGe  206 (240)
                      |.-+|.||.|+        ..|  +......||.|+-
T Consensus       733 N~~~G~C~~C~G~G~~~~~~~f--~~~~~~~C~~C~G  767 (924)
T TIGR00630       733 NVKGGRCEACQGDGVIKIEMHF--LPDVYVPCEVCKG  767 (924)
T ss_pred             CCCCCCCCCCccceEEEEEccC--CCCcccCCCCcCC
Confidence            55579999996        223  3445678999974


No 492
>PRK14526 adenylate kinase; Provisional
Probab=22.98  E-value=89  Score=27.18  Aligned_cols=42  Identities=17%  Similarity=0.282  Sum_probs=28.7

Q ss_pred             HHHhhhhhcCCCCCCCccccccccc---eeecCCCCceeeeeCCC
Q 026283          173 TVANNFVIKGACPACKREFIGSKSQ---IIRCAGCGNIVWQPEGD  214 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~nnt---~~~CpnCGe~l~v~~g~  214 (240)
                      ...+|-.--..||+||..|-=..+.   .-.|..||+.|.+..++
T Consensus       114 ~~~~Rl~~R~~~~~~g~~y~~~~~pp~~~~~~~~~~~~l~~R~DD  158 (211)
T PRK14526        114 LLIKRLSGRRICKSCNNIFNIYTLPTKEKGICDVCKGDLYQRKDD  158 (211)
T ss_pred             HHHHHHHCCCcccccCCccccccCCCCccCcCCCCCCeeeccCCC
Confidence            3446666667899999887544332   34699999988766554


No 493
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=22.87  E-value=39  Score=27.34  Aligned_cols=28  Identities=29%  Similarity=0.564  Sum_probs=21.9

Q ss_pred             hhcCCCCCCCccccccccceeecCCCCcee
Q 026283          179 VIKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       179 LIeg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      -..--|.-||..  .|+-|.-+|.+||-+-
T Consensus        14 ktHtlCrRCG~~--syH~qK~~CasCGyps   41 (91)
T PTZ00073         14 KTHTLCRRCGKR--SFHVQKKRCASCGYPS   41 (91)
T ss_pred             cCcchhcccCcc--ccccccccchhcCCch
Confidence            344569999986  5788899999999753


No 494
>PHA02929 N1R/p28-like protein; Provisional
Probab=22.68  E-value=50  Score=30.18  Aligned_cols=22  Identities=27%  Similarity=0.661  Sum_probs=14.9

Q ss_pred             HHHhhhhhcCCCCCCCccccccccc
Q 026283          173 TVANNFVIKGACPACKREFIGSKSQ  197 (240)
Q Consensus       173 wWlkRnLIeg~CPvC~~eFtG~nnt  197 (240)
                      -|+++   ...||+|..+|+++..+
T Consensus       211 ~Wl~~---~~tCPlCR~~~~~v~~~  232 (238)
T PHA02929        211 IWKKE---KNTCPVCRTPFISVIKS  232 (238)
T ss_pred             HHHhc---CCCCCCCCCEeeEEeee
Confidence            35554   46899999888865443


No 495
>PRK01343 zinc-binding protein; Provisional
Probab=22.68  E-value=43  Score=24.88  Aligned_cols=14  Identities=21%  Similarity=0.551  Sum_probs=9.7

Q ss_pred             hhcCCCCCCCcccc
Q 026283          179 VIKGACPACKREFI  192 (240)
Q Consensus       179 LIeg~CPvC~~eFt  192 (240)
                      +-.-.||+|+.+++
T Consensus         7 ~p~~~CP~C~k~~~   20 (57)
T PRK01343          7 RPTRPCPECGKPST   20 (57)
T ss_pred             CCCCcCCCCCCcCc
Confidence            34567888888775


No 496
>PRK12268 methionyl-tRNA synthetase; Reviewed
Probab=22.57  E-value=36  Score=33.07  Aligned_cols=27  Identities=33%  Similarity=1.030  Sum_probs=16.7

Q ss_pred             hhhcCCCCCCCccccccccceeecCCCCcee
Q 026283          178 FVIKGACPACKREFIGSKSQIIRCAGCGNIV  208 (240)
Q Consensus       178 nLIeg~CPvC~~eFtG~nnt~~~CpnCGe~l  208 (240)
                      ..|.|.||.|+.+  +..+.  .|-+||..+
T Consensus       138 ~~v~g~cp~c~~~--~~~G~--~ce~cg~~~  164 (556)
T PRK12268        138 RYVEGTCPYCGYE--GARGD--QCDNCGALL  164 (556)
T ss_pred             cceeccCCCCCCc--ccCCc--hhhhccccC
Confidence            4566899999852  22332  367777654


No 497
>PF08804 gp32:  gp32 DNA binding protein like;  InterPro: IPR012339 This entry is represented by the Bacteriophage T4, Gp32, single-stranded DNA-binding protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. Gp32 is essential for T4 DNA replication, recombination and repair, acting to stimulate replisome processing and accuracy through its binding to ssDNA as the replication fork advances. The crystal structure of Gp32 shows an ssDNA binding cleft comprised of regions from three structural subdomains, through which ssDNA can slide freely []. The structure of Gp32 is similar to other phage ssDNA-binding proteins such as Gp2.5 from bacteriophage T4, and gene V protein, both of which have a nucleic acid-binding OB-type fold. However, Gp32 contains a zinc-finger subdomain at residues 63-111 that is not found in the other two phage proteins.; GO: 0003697 single-stranded DNA binding; PDB: 1GPC_A 2A1K_B 2ATQ_B.
Probab=22.52  E-value=11  Score=30.64  Aligned_cols=15  Identities=27%  Similarity=0.510  Sum_probs=10.6

Q ss_pred             CCCCCCCc--ccccccc
Q 026283          182 GACPACKR--EFIGSKS  196 (240)
Q Consensus       182 g~CPvC~~--eFtG~nn  196 (240)
                      |.||||++  +.-.+|+
T Consensus        59 d~cPVc~~~~~~~lwn~   75 (94)
T PF08804_consen   59 DSCPVCEHISNRDLWNS   75 (94)
T ss_dssp             TTSHHHHHHHHTTHHHH
T ss_pred             CCCCccccccccccccc
Confidence            58999998  6555543


No 498
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=22.52  E-value=38  Score=29.31  Aligned_cols=17  Identities=18%  Similarity=0.501  Sum_probs=14.7

Q ss_pred             CCCCCCcccccccccee
Q 026283          183 ACPACKREFIGSKSQII  199 (240)
Q Consensus       183 ~CPvC~~eFtG~nnt~~  199 (240)
                      .|+.|++.||=|.--+.
T Consensus        30 eC~~C~~RFTTyErve~   46 (147)
T TIGR00244        30 ECLECHERFTTFERAEL   46 (147)
T ss_pred             cCCccCCccceeeeccc
Confidence            69999999999987665


No 499
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=22.37  E-value=46  Score=19.87  Aligned_cols=13  Identities=31%  Similarity=0.759  Sum_probs=10.1

Q ss_pred             CCCCCCccccccc
Q 026283          183 ACPACKREFIGSK  195 (240)
Q Consensus       183 ~CPvC~~eFtG~n  195 (240)
                      -|++|+..|..-+
T Consensus         3 ~C~~C~k~f~~~~   15 (27)
T PF12171_consen    3 YCDACDKYFSSEN   15 (27)
T ss_dssp             BBTTTTBBBSSHH
T ss_pred             CcccCCCCcCCHH
Confidence            4999999887643


No 500
>PF00452 Bcl-2:  Apoptosis regulator proteins, Bcl-2 family;  InterPro: IPR000712 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 2WH6_A 1K3K_A 1AF3_A 3PK1_B 2K7W_A 1F16_A 3PL7_C 2VM6_A 3I1H_A 3MQP_A ....
Probab=22.34  E-value=3.1e+02  Score=20.39  Aligned_cols=58  Identities=14%  Similarity=0.213  Sum_probs=0.0

Q ss_pred             HHHHHHhhhhhh--hhHhHHhhhh-hhhhhchhHHHHHHHhhCC---CCchHHHHHHHHHHHHH
Q 026283           92 AVRARELDREFA--ISVRWRSFRM-DFSRNWPRYRKQLNDFLNT---PLGRSFATIFFLWFALS  149 (240)
Q Consensus        92 ~e~A~eiD~~fg--i~rR~R~f~~-D~~r~wP~yrrql~~F~~T---~lG~wL~tl~~~wll~S  149 (240)
                      .+.+.+++++|.  +++-.+.+.. +-......|..-..+....   .+|+.+++|.|...+..
T Consensus         2 ~~i~~~~e~~~~~~f~~~~~~l~~~~~~~~~~~f~~v~~~lf~d~~inWGRIval~~f~~~l~~   65 (101)
T PF00452_consen    2 RRIADELERKYEDFFENMLNQLNINTPDNAYETFNEVAEELFEDGGINWGRIVALFAFAGALAV   65 (101)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCSSSTTTHHHHHHHHHHHHTTTSSTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCCCcchHHHHHHHHHHHHhccCCCCHHHHHHHHHHHHHHHH


Done!