BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026285
         (240 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I9W|A Chain A, Crystal Structure Of The E. Coli Histidine Kinase Sensor
           Tors Sensor Domain
          Length = 290

 Score = 32.7 bits (73), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 34  NEAAPQALKGDEMLKNIFLD--------VKKKFETALGVLRKEKITIAPEDPAAVSQYAN 85
           NE    AL+  +M+ N+ L+        ++K+   A+ +L++ +I I  EDP   +Q A 
Sbjct: 174 NELRLSALRVQQMVMNLGLEQIQKNAPTLEKQLNNAVKILQRRQIRI--EDPGVRAQVAT 231

Query: 86  VMKTVREKADLFS 98
            + TV + +DL +
Sbjct: 232 TLTTVSQYSDLLA 244


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.130    0.339 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,850,335
Number of Sequences: 62578
Number of extensions: 225982
Number of successful extensions: 829
Number of sequences better than 100.0: 56
Number of HSP's better than 100.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 34
Number of HSP's that attempted gapping in prelim test: 798
Number of HSP's gapped (non-prelim): 63
length of query: 240
length of database: 14,973,337
effective HSP length: 96
effective length of query: 144
effective length of database: 8,965,849
effective search space: 1291082256
effective search space used: 1291082256
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)