BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026290
         (240 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3
          Length = 641

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 31/64 (48%)

Query: 101 KEYPFIEIFHSPEQASTRERGADPNITKYAVKVLPFNYDLSAYGFREYFKRQGIRHLQKY 160
           + YP +E+ + PE+ S     ++ N+ K  +K +     + A+ FR   + +    LQ Y
Sbjct: 74  RRYPDLELKYGPEKVSPENDTSEVNLPKQVIKQISTTLGIEAFYFRNDSEYRQFEGLQGY 133

Query: 161 LKTN 164
            + N
Sbjct: 134 QEGN 137


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.326    0.139    0.434 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 92,321,491
Number of Sequences: 539616
Number of extensions: 3685919
Number of successful extensions: 9803
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 9795
Number of HSP's gapped (non-prelim): 12
length of query: 240
length of database: 191,569,459
effective HSP length: 114
effective length of query: 126
effective length of database: 130,053,235
effective search space: 16386707610
effective search space used: 16386707610
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)