Citrus Sinensis ID: 026330


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MAFEQYFAREWKSIASAATGSENYNGCFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRPPAFGNQALLYPTSNTGQQLPYRNPYQSQNYDPHGQHSYGGFEGNSPSPLLNLGGTALSGFQHPVVGMFGEMVYASVFGNSESLYTYPNSYHSNPRLRRHEMQAVKSLNRISIFLFCCFLLCLIVF
cccHHHHHHHHHHHHHHcccccccccccccccccccccccEEccccccccHHHHHHHHHccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
************************NGCFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYG*************************************************************SYGGFEGNSPSPLLNLGGTALSGFQHPVVGMFGEMVYASVFGNSESLYTYPNSYHS***LRRHEMQAVKSLNRISIFLFCCFLLCLIVF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFEQYFAREWKSIASAATGSENYNGCFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRPPAFGNQALLYPTSNTGQQLPYRNPYQSQNYDPHGQHSYGGFEGNSPSPLLNLGGTALSGFQHPVVGMFGEMVYASVFGNSESLYTYPNSYHSNPRLRRHEMQAVKSLNRISIFLFCCFLLCLIVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase RMA1 E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of aquaporin PIP2-1. Forms a ubiquitin ligase complex in cooperation with the E2 enzymes UCB8/UCB10.probableO64425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JM7, chain A
Confidence level:very confident
Coverage over the Query: 25-90
View the alignment between query and template
View the model in PyMOL