Citrus Sinensis ID: 026336


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MSTLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQPGTAQNVDKSTSLARKVFRLFKFVNDLHALISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAELLGRISLFCWMGSSVCSTLVELGELGRLSTSMKKLEKELKDSDKHKNEQYQAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQVSNSTANFRLISSLLC
ccccHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcc
******T*AELALVVLYLNKAEARDKICRAIQYGSKFLSDGQPGTAQNVDKSTSLARKVFRLFKFVNDLHALISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAELLGRISLFCWMGSSVCSTLVELGELGRL*************************LKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQVSNSTANFRLISSLLC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQPGTAQNVDKSTSLARKVFRLFKFVNDLHALISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAELLGRISLFCWMGSSVCSTLVELGELGRLSTSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQVSNSTANFRLISSLLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal membrane protein 11-1 Involved in peroxisomal proliferation.confidentQ10SM7
Peroxisomal membrane protein 11C Involved in peroxisomal proliferation. Promotes peroxisomal duplication, aggregation or elongation without fission.confidentQ9LQ73
Peroxisomal membrane protein 11D Involved in peroxisomal proliferation. Promotes peroxisomal duplication, aggregation or elongation without fission.probableO80845

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted