BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026365
(239 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3NEP|X Chain X, 1.55a Resolution Structure Of Malate Dehydrogenase From
Salinibacter Ruber
Length = 314
Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 12/66 (18%)
Query: 69 YEACGRTVNPVNGAVGLLWTGNW--------HVCQAAVETVLRGG---TLRPVPELLNSC 117
YEA G N V G G+L TG + V V+ +L GG T+ P+P +
Sbjct: 129 YEASGFPTNRVMGMAGVLDTGRFRSFIAEELDVSVRDVQALLMGGHGDTMVPLPR-YTTV 187
Query: 118 GGSPTP 123
GG P P
Sbjct: 188 GGIPVP 193
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.133 0.412
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,515,590
Number of Sequences: 62578
Number of extensions: 237802
Number of successful extensions: 759
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 759
Number of HSP's gapped (non-prelim): 1
length of query: 239
length of database: 14,973,337
effective HSP length: 96
effective length of query: 143
effective length of database: 8,965,849
effective search space: 1282116407
effective search space used: 1282116407
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)