Citrus Sinensis ID: 026392


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MAQNDSLAKFLDTAVDAAKRAGEIIRNGFYQTKNVEHKGQVDLVTETDKACEDLIFNHLKQQFPAHKFIGEETTAACGATELTDEPTWIVDPLDGTTNFVHGFPFVCISIGLTIGKIPIVGVVYNPIMDELFTGVRGQGAFFNGKPIKVSSQTELVKSLLATEAGTKRDKPTLDASTNRINSLLFKVRSLRMSGSCALNLCGIACGRLDLFYELGFGGPWDVAAGVVIVEEAGGLVYDP
ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccEEEEEcccccccccccccccEEEEEEEEccEEEEEEEEccccccEEEEEcccccccccccccccccccccccEEECccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHcccEEccc
****DSLAKFLDTAVDAAKRAGEIIRNGFYQTKNVEHKGQVDLVTETDKACEDLIFNHLKQQFPAHKFIGEETTAACGATELTDEPTWIVDPLDGTTNFVHGFPFVCISIGLTIGKIPIVGVVYNPIMDELFTGVRGQGAFFNGKPIKVSSQTELVKSLLATEAGTKRDKPTLDASTNRINSLLFKVRSLRMSGSCALNLCGIACGRLDLFYELGFGGPWDVAAGVVIVEEAGGLVYDP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQNDSLAKFLDTAVDAAKRAGEIIRNGFYQTKNVEHKGQVDLVTETDKACEDLIFNHLKQQFPAHKFIGEETTAACGATELTDEPTWIVDPLDGTTNFVHGFPFVCISIGLTIGKIPIVGVVYNPIMDELFTGVRGQGAFFNGKPIKVSSQTELVKSLLATEAGTKRDKPTLDASTNRINSLLFKVRSLRMSGSCALNLCGIACGRLDLFYELGFGGPWDVAAGVVIVEEAGGLVYDP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inositol-phosphate phosphatase Phosphatase acting on L-galactose 1-phosphate (L-Gal 1-P), D-myoinositol 3-phosphate (D-Ins 3-P) and D-myoinositol 1-phosphate (D-Ins 1-P). Can also use beta-glycerophosphate (glycerol 2-P) and, to a leser extend, D-galactose 1-phosphate (D-Gal 1-P), alpha-D-glucose 1-phosphate (a-D-Glc 1-P), D-manitol 1-phosphate and adenosine 2'-monophosphate as substrates. No activity with D-fructose 1-phosphate (D-Fru 1-P), fructose 1,6-bisphosphate (Fru 1,6-bisP), D-glucose 6-phosphate (D-Glc 6-P), D-alpha-glycerophosphate (glycerol 3-P), D-sorbitol 6-phosphate and D-myoinositol 2-phosphate. The C1 phosphate position in a six-member ring substrate is important for catalysis.confidentQ9M8S8
Inositol monophosphatase 3 Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides.probableP54928
Inositol monophosphatase 2 Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides.probableP54927

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.25Inositol-phosphate phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BJI, chain A
Confidence level:very confident
Coverage over the Query: 5-239
View the alignment between query and template
View the model in PyMOL