BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026445
         (238 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MQK|A Chain A, Cbf5-Nop10-Gar1 Complex Binding With 17mer Rna Containing
           Aca Trinucleotide
          Length = 328

 Score = 26.9 bits (58), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 5/56 (8%)

Query: 144 QKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIVVEGPRCS-----LRSRKVY 194
           Q  L A   YVA   +  D   DK+ Q +K    EI+   P  S     LR+RKVY
Sbjct: 94  QALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVY 149


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.132    0.362 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,000,780
Number of Sequences: 62578
Number of extensions: 219531
Number of successful extensions: 703
Number of sequences better than 100.0: 29
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 23
Number of HSP's that attempted gapping in prelim test: 696
Number of HSP's gapped (non-prelim): 30
length of query: 238
length of database: 14,973,337
effective HSP length: 96
effective length of query: 142
effective length of database: 8,965,849
effective search space: 1273150558
effective search space used: 1273150558
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)