Citrus Sinensis ID: 026476


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MSGPQCCANPPTLNPNSGAGHVEKLGGLNAYVTGSPDSKLAVLLISDVYGYEAPNLRKLADKVAAAGFYVAVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITAIGAAGFCWGAKVVVQLGKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPALVKEFEEALNAKSGVDSFVKIFPKVAHGWTVRYNVEDETAVKAAEEAHHNLLEWFAKYVK
cccccccccccccccccccCEEEECccEEEEEEcccccccEEEEEEccccccccHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHccccccccEEEEEccccccHHHHccccccEEEEEccccccccHHHHHHHHHHHHccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc
****QCCANPPTLNPNSGAGHVEKLGGLNAYVTGSPDSKLAVLLISDVYGYEAPNLRKLADKVAAAGFYVAVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITAIGAAGFCWGAKVVVQLGKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPALVKEFEEALNAKSGVDSFVKIFPKVAHGWTVRYNVEDETAVKAAEEAHHNLLEWFAKYVK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGPQCCANPPTLNPNSGAGHVEKLGGLNAYVTGSPDSKLAVLLISDVYGYEAPNLRKLADKVAAAGFYVAVPDFFHGDPYVADGGKPLQEWIKDHGVDKGFEEAKPVIQALKSKGITAIGAAGFCWGAKVVVQLGKREFIQAAVLLHPSFVTVDDIKGVEVPLSILGAEIDRLSPPALVKEFEEALNAKSGVDSFVKIFPKVAHGWTVRYNVEDETAVKAAEEAHHNLLEWFAKYVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein AIM2 probableP39721
Carboxymethylenebutenolidase homolog Cysteine hydrolase.probableQ7TP52
Carboxymethylenebutenolidase homolog Cysteine hydrolase.probableQ8R1G2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZI8, chain A
Confidence level:confident
Coverage over the Query: 28-238
View the alignment between query and template
View the model in PyMOL
Template: 3PFB, chain A
Confidence level:confident
Coverage over the Query: 15-209,220-234
View the alignment between query and template
View the model in PyMOL