BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026479
         (238 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1
           Transcriptional Activator Complex
          Length = 387

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (60%), Gaps = 4/74 (5%)

Query: 58  EDRALAALKNHKEAEKRRRERINSHLNKLRSIL-SCNS---KLDKASLLARVVQRVRELK 113
           + R   A + H + EKRRR+++NS +++L S++ +CN+   KLDK ++L   VQ ++ L+
Sbjct: 7   QGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLR 66

Query: 114 EQTIELTEVESFPS 127
             T   TE    P+
Sbjct: 67  GATNPYTEANYKPT 80


>pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex
           Structure Of Human Clock-bmal1 Basic Helix-loop-helix
           Domains With E-box Dna
          Length = 73

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 38/55 (69%), Gaps = 4/55 (7%)

Query: 68  HKEAEKRRRERINSHLNKLRSIL-SCNS---KLDKASLLARVVQRVRELKEQTIE 118
           H + EKRRR+++NS +++L S++ +CN+   KLDK ++L   VQ ++ L+   +E
Sbjct: 13  HSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAWLE 67


>pdb|4F3L|A Chain A, Crystal Structure Of The Heterodimeric Clock:bmal1
           Transcriptional Activator Complex
          Length = 361

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 51  GLTETTPEDRALAALKNHKEAEKRRRERINSHLNKLRSILSCNS-KLDKASLLARVVQRV 109
           G  E   +D+A    +N  ++EK+RR++ N  + +L S+L  N+ K+DK+++L + +  +
Sbjct: 1   GAVEEDDKDKAKRVSRN--KSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFL 58

Query: 110 RELKEQTIE 118
           R+ KE T +
Sbjct: 59  RKHKETTAQ 67


>pdb|4H10|B Chain B, Intermolecular Recognition Revealed By The Complex
           Structure Of Human Clock-bmal1 Basic Helix-loop-helix
           Domains With E-box Dna
          Length = 71

 Score = 30.8 bits (68), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 58  EDRALAALKNHKEAEKRRRERINSHLNKLRSILSCNS-KLDKASLLARVVQRVRELKEQT 116
           +D+  A   +  ++EK+RR++ N  + +L S+L  N+ K+DK+++L + +  +R+ KE T
Sbjct: 2   DDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEIT 61

Query: 117 IEL 119
             L
Sbjct: 62  AWL 64


>pdb|1AN4|A Chain A, Structure And Function Of The BHLHZ DOMAIN OF USF
 pdb|1AN4|B Chain B, Structure And Function Of The BHLHZ DOMAIN OF USF
          Length = 65

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 6/53 (11%)

Query: 68  HKEAEKRRRERINSHLNKLRSIL------SCNSKLDKASLLARVVQRVRELKE 114
           H E E+RRR++IN+ + +L  I+      S  S   K  +L++    ++EL++
Sbjct: 9   HNEVERRRRDKINNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQELRQ 61


>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|B Chain B, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|C Chain C, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|D Chain D, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|E Chain E, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|F Chain F, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|G Chain G, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
 pdb|4FR8|H Chain H, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In
           Complex With Nitroglycerin
          Length = 500

 Score = 27.7 bits (60), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLQLGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|I Chain I, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|J Chain J, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|K Chain K, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|1ZUM|L Chain L, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Apo Form
 pdb|2ONM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|I Chain I, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|J Chain J, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|K Chain K, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
 pdb|2ONM|L Chain L, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Nad+
          Length = 500

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|B Chain B, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|C Chain C, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|D Chain D, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|E Chain E, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|F Chain F, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|G Chain G, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONN|H Chain H, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|2ONO|A Chain A, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|B Chain B, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|C Chain C, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|D Chain D, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|E Chain E, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|F Chain F, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|G Chain G, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONO|H Chain H, Arg475gln Mutant Of Mitochondrial Aldehyde Dehydrogenase,
           Apo Form, Pseudo-Merohedrally Twinned
 pdb|2ONP|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|B Chain B, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|C Chain C, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|D Chain D, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|E Chain E, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|F Chain F, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|G Chain G, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
 pdb|2ONP|H Chain H, Arg475gln Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Complexed With Nad+
          Length = 500

 Score = 27.7 bits (60), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|B Chain B, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|C Chain C, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|D Chain D, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|E Chain E, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|F Chain F, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|G Chain G, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1NZW|H Chain H, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nadh And Mg2+
 pdb|1O04|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|B Chain B, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|C Chain C, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|D Chain D, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|E Chain E, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|F Chain F, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|G Chain G, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
 pdb|1O04|H Chain H, Cys302ser Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase Complexed With Nad+ And Mg2+
          Length = 500

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|B Chain B, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|C Chain C, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|D Chain D, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|E Chain E, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|F Chain F, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|G Chain G, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N81|H Chain H, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Apo Form
 pdb|3N82|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|B Chain B, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|C Chain C, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|D Chain D, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|E Chain E, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|F Chain F, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|G Chain G, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N82|H Chain H, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nadh Complex
 pdb|3N83|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|B Chain B, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|C Chain C, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|D Chain D, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|E Chain E, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|F Chain F, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|G Chain G, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
 pdb|3N83|H Chain H, T244a Mutant Of Human Mitochondrial Aldehyde
           Dehydrogenase, Nad Complex
          Length = 500

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
 pdb|3N80|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form
          Length = 500

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
 pdb|3INL|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant,
           Aldh22, Complexed With Agonist Alda-1
          Length = 500

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|B Chain B, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|C Chain C, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|D Chain D, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|E Chain E, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|F Chain F, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|G Chain G, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1O05|H Chain H, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase
 pdb|1NZX|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZX|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ In The Presence Of Low Mg2+
 pdb|1NZZ|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1NZZ|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Low Mg2+
 pdb|1O00|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O00|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mg2+ Showing Dual Nad(H) Conformations
 pdb|1O01|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O01|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Crotonaldehyde, Nad(H) And Mg2+
 pdb|1O02|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|1O02|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nadh In The Presence Of Mg2+
 pdb|3INJ|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3INJ|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Agonist Alda-1
 pdb|3SZ9|A Chain A, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|B Chain B, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|C Chain C, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|D Chain D, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|E Chain E, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|F Chain F, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|G Chain G, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|3SZ9|H Chain H, Crystal Structure Of Human Aldh2 Modified With The
           Beta-Elimination Product Of Aldi-3;
           1-(4-Ethylbenzene)prop-2-En-1-One
 pdb|4FQF|A Chain A, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
 pdb|4FQF|B Chain B, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
 pdb|4FQF|C Chain C, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
 pdb|4FQF|D Chain D, Crystal Structure Of A Thionitrate Intermediate Of Human
           Aldehyde Dehydrogenase-2
          Length = 500

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 262 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 292


>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|B Chain B, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|C Chain C, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|D Chain D, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|E Chain E, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|F Chain F, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|G Chain G, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|1CW3|H Chain H, Human Mitochondrial Aldehyde Dehydrogenase Complexed With
           Nad+ And Mn2+
 pdb|2VLE|A Chain A, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|B Chain B, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|C Chain C, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|D Chain D, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|E Chain E, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|F Chain F, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|G Chain G, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
 pdb|2VLE|H Chain H, The Structure Of Daidzin, A Naturally Occurring Anti
           Alcohol-Addiction Agent, In Complex With Human
           Mitochondrial Aldehyde Dehydrogenase
          Length = 494

 Score = 27.3 bits (59), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 176 LKSEMVTLGGRIRNVLIIAAEKDHSIESVHF 206
           LK   + LGG+  N+++  A+ D ++E  HF
Sbjct: 256 LKRVTLELGGKSPNIIMSDADMDWAVEQAHF 286


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.132    0.357 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,273,354
Number of Sequences: 62578
Number of extensions: 165996
Number of successful extensions: 517
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 505
Number of HSP's gapped (non-prelim): 18
length of query: 238
length of database: 14,973,337
effective HSP length: 96
effective length of query: 142
effective length of database: 8,965,849
effective search space: 1273150558
effective search space used: 1273150558
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)