Citrus Sinensis ID: 026508

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MVLTMAAQSYTTTPLHRKITNKPLCPPLLSLKPRSLTAKHLRTTQSTSLPRISVSAAATSSIEVKESSASIQPSKSKSLPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPTVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
ccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEECcEEccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccEEEccEEEEEcccccccccHHHHHHHHHHHcccccccEEEEccccccccccccccHHHHHHEEEEEEc
***T***QSYTTTPLHRKITNKPLCPPLLSLKPRSLTAKHLRTTQSTSLPRISVSAAATSSIEVKESSASI*P*KSKSLPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPTVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLTMAAQSYTTTPLHRKITNKPLCPPLLSLKPRSLTAKHLRTTQSTSLPRISVSAAATSSIEVKESSASIQPSKSKSLPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPTVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP. Also converts 4-diphosphocytidyl-2C-methyl-D-erythritol into 2C-methyl-D-erythritol 3,4-cyclophosphate and CMP. Is essential for chloroplast development.confidentQ9CAK8
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic Converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP. Also converts 4-diphosphocytidyl-2C-methyl-D-erythritol into 2C-methyl-D-erythritol 3,4-cyclophosphate and CMP.probableQ9M4W3
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase Converts 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate into 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MECDP) and CMP.probableQ1IVA8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.6.-.-Phosphorus-oxygen lyases.probable
4.6.1.-Phosphorus-oxygen lyases.probable
4.6.1.122-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PMP, chain A
Confidence level:very confident
Coverage over the Query: 79-237
View the alignment between query and template
View the model in PyMOL