Citrus Sinensis ID: 026517


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MSIGDGDDDHKNPYSLNSKIMVTAIISLTIVIVVVLLLHIYARCVLRRQARRRSVIRSLDLVNNRVTHSTETPPPPKTGLDPTVIAALPIFVYKQTDGGQDDGLAAAIECAVCLSNLENEEMARVLPNCNHTFHAECIDKWLGSHSTCPICRTGAEPRPQPESREGPVSIAPTAPPLLVSAEGTSSNSGNNNGVEANSAKVTAGSSSRLSSFRRILNGDWDRSSRRIQFEIADLERQ
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***************LNSKIMVTAIISLTIVIVVVLLLHIYARCVLRRQA******************************DPTVIAALPIFVYKQTDGGQDDGLAAAIECAVCLSNLENEEMARVLPNCNHTFHAECIDKWLGSHSTCPICRTGA**********************************************************************************
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIGDGDDDHKNPYSLNSKIMVTAIISLTIVIVVVLLLHIYARCVLRRQARRRSVIRSLDLVNNRVTHSTETPPPPKTGLDPTVIAALPIFVYKQTDGGQDDGLAAAIECAVCLSNLENEEMARVLPNCNHTFHAECIDKWLGSHSTCPICRTGAEPRPQPESREGPVSIAPTAPPLLVSAEGTSSNSGNNNGVEANSAKVTAGSSSRLSSFRRILNGDWDRSSRRIQFEIADLERQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase ATL41 E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8, UBC10, UBC11, UBC28, UBC29, UBC30, UBC35 and UBC36 in vitro.probableQ9SLC3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 72-157
View the alignment between query and template
View the model in PyMOL
Template: 1UJR, chain A
Confidence level:probable
Coverage over the Query: 207-235
View the alignment between query and template
View the model in PyMOL
Template: 2KNC, chain A
Confidence level:probable
Coverage over the Query: 18-47
View the alignment between query and template
View the model in PyMOL