Citrus Sinensis ID: 026523

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------

MLGYEGVRSKDDGKFEVDLEGGDGERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSLSRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTSLIILILTSFMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVLRSSDG

cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc

************************ERLYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDLLRGNSGLLLFLSILPFILLWPLHVYHQKHPVNLIVLGLFTVSLSRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPILFTSLIILILTSFMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVLRSS**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
BI1-like protein		confident	Q94A20
Protein lifeguard 4	Anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. Can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.	probable	Q9HC24
Protein lifeguard 4	Anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. Can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.	probable	Q9DA39

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted