BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026536
         (237 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome
           P450 2c8
 pdb|1PQ2|B Chain B, Crystal Structure Of Human Drug Metabolizing Cytochrome
           P450 2c8
 pdb|2NNH|A Chain A, Cyp2c8dh Complexed With 2 Molecules Of 9-Cis Retinoic Acid
 pdb|2NNH|B Chain B, Cyp2c8dh Complexed With 2 Molecules Of 9-Cis Retinoic Acid
 pdb|2NNI|A Chain A, Cyp2c8dh Complexed With Montelukast
 pdb|2NNJ|A Chain A, Cyp2c8dh Complexed With Felodipine
 pdb|2VN0|A Chain A, Cyp2c8dh Complexed With Troglitazone
          Length = 476

 Score = 27.3 bits (59), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 52  LTSGCKMVALLGRPRKPLLKDSATTGTIFGFRKGRVCLAIQEDPHCL 98
           +T G  +++  G+  K + + S TT   FG  K  +   +QE+ HCL
Sbjct: 88  ITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCL 134


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,376,555
Number of Sequences: 62578
Number of extensions: 228367
Number of successful extensions: 445
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 444
Number of HSP's gapped (non-prelim): 3
length of query: 237
length of database: 14,973,337
effective HSP length: 96
effective length of query: 141
effective length of database: 8,965,849
effective search space: 1264184709
effective search space used: 1264184709
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)