BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026536
(237 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome
P450 2c8
pdb|1PQ2|B Chain B, Crystal Structure Of Human Drug Metabolizing Cytochrome
P450 2c8
pdb|2NNH|A Chain A, Cyp2c8dh Complexed With 2 Molecules Of 9-Cis Retinoic Acid
pdb|2NNH|B Chain B, Cyp2c8dh Complexed With 2 Molecules Of 9-Cis Retinoic Acid
pdb|2NNI|A Chain A, Cyp2c8dh Complexed With Montelukast
pdb|2NNJ|A Chain A, Cyp2c8dh Complexed With Felodipine
pdb|2VN0|A Chain A, Cyp2c8dh Complexed With Troglitazone
Length = 476
Score = 27.3 bits (59), Expect = 7.9, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 25/47 (53%)
Query: 52 LTSGCKMVALLGRPRKPLLKDSATTGTIFGFRKGRVCLAIQEDPHCL 98
+T G +++ G+ K + + S TT FG K + +QE+ HCL
Sbjct: 88 ITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCL 134
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.137 0.411
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,376,555
Number of Sequences: 62578
Number of extensions: 228367
Number of successful extensions: 445
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 444
Number of HSP's gapped (non-prelim): 3
length of query: 237
length of database: 14,973,337
effective HSP length: 96
effective length of query: 141
effective length of database: 8,965,849
effective search space: 1264184709
effective search space used: 1264184709
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)