Citrus Sinensis ID: 026544

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------

MEKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYYEILNSPERLTCIFLFLSRQTLIVVIKFSFHFNYVFKYGIHVVDYLYILRQTVAL

cccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc

*****EHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSS***************RIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYYEILNSPERLTCIFLFLSRQTLIVVIKFSFHFNYVFKYGIHVVDYLYILRQTVA*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEKEREHHVYxxxxxxxxxxxxxxxxxxxxxAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYYEILNSPERLTCIFLFLSRQTLIVVIKFSFHFNYVFKYGIHVVDYLYILRQTVAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
14-3-3-like protein C		probable	Q96452
14-3-3 protein epsilon	Positively regulates Ras-mediated pathways. Acts downstream or parallel to Raf, but upstream of nuclear factors in Ras signaling. Three mutants have been isolated, that suppress the rough eye phenotype caused by mutated Ras1 (sev-Ras1 v12). Inhibits yki activity by restricting its nuclear localization.	probable	P92177
14-3-3-like protein GF14-E	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	probable	Q6EUP4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UBW, chain A
Confidence level:very confident
Coverage over the Query: 4-209
View the alignment between query and template
View the model in PyMOL